SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427733984|ref|YP_007053528.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427733984|ref|YP_007053528.1|
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily beta-Roll 2.92e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00071
Further Details:      
 
Domain Number 2 Region: 167-247
Classification Level Classification E-value
Superfamily beta-Roll 2.96e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 490-587
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000183
Family Serralysin-like metalloprotease, C-terminal domain 0.0005
Further Details:      
 
Domain Number 4 Region: 248-390
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000115
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 5 Region: 574-737
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000549
Family Serralysin-like metalloprotease, C-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427733984|ref|YP_007053528.1|
Sequence length 762
Comment putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MAFVRGRRRRDDNLEGTNSVDTIFGYSGNDTLIGLGGDDYMRGDEGDDSLEGGDGNDQLI
GNEGNDELLGGNGNDFVKGEEGNDSLDGGDGDDQLFGNAGDDEIIAGAGNDYLDGGDGED
GLDGGDGNDTLLGGSNSNIRTTREEIIKDEEGNIVFTGTFPTIEFIGGDTLIGGAGDDLI
LANAGDDVVDAGLDNDTVVGGAGNDLIFAGSGEDEITGGSGNDTILGESGNDTLIGSGGE
DLIIGDQDALGGPDGNDEINAGSDNDTVYGGGGSDTINGGKGDDILDGGDSRSTGLISRD
SNGNDQLFGGRGNDVLRGGLGSDTLDGGGTTAGERDILIGSGVLDSGGTFSDGVSDLFIL
GNEETFLYAGGTGDVIGNNIFGQGDRAIIQLFENGVDKIQVPNPDQVATAVIGNSTFILI
PVSGGFEIIAELRDFTGTLAPDTFITPPIDNSGDDDFQGTEGNDILDGGEGNDILAGLDG
DDILDGGAGNDNLDGGNGIDTASYENDTAGIQVNLAAQTATDGFGGNDTLLNIENVVGSG
FADLIIGDAQDNNLNGGAGDDTLTGGAGNDIIEGNDGTDTVNYENDTAGIQVNLTAQAAI
DGFGGNDNLLNIENVVGSDFNDVIFGGNGDNNLNGGAGNDILVGGAGNDTLVGAGSQAGE
LDQLYGEADGNTDVFVLGDTSSAFYIGGGSTFGLSDRADIFNFENGVDQIQVNTSGGVIV
NSLGSQTDLYILTQANGNFEIIARLANFTDTSIASNGTFISA
Download sequence
Identical sequences K9R6A2
gi|427733984|ref|YP_007053528.1| WP_015116559.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]