SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734238|ref|YP_007053782.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734238|ref|YP_007053782.1|
Domain Number 1 Region: 79-433
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.74e-75
Family Extended AAA-ATPase domain 0.0000000146
Further Details:      
 
Domain Number 2 Region: 9-44
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734238|ref|YP_007053782.1|
Sequence length 452
Comment endopeptidase Clp ATP-binding regulatory subunit ClpX [Rivularia sp. PCC 7116]
Sequence
MTGKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELLDTNGAATASQP
APRSEPPQKRRTRSASLSFNQIPKPREIKKYLDEHVIGQDEAKKVLSVAVYNHYKRLSLV
NGSKGDGDREDDDSDSVELQKSNILLIGPTGCGKTLLAQTLAKILDVPFAVADATTLTEA
GYVGEDVENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQAL
LKMLEGTVANVPPQGGRKHPYQDCIQIDTSNILFVCGGAFVGLEKVVEQRTGKKSIGFLQ
PGEGQSKGKRVADTVRHLEPGDLVKFGMIPEFIGRVPMVAVVDPLDEEALMSILTKPRSA
LVKQYQKLLNMDSVQLEFNGEALKAIAQEAYRRKTGARALRGIVEELMLDVMYELPSRKD
VNVCTVTREMVEKRSTAELLVHPSSLPKPESA
Download sequence
Identical sequences K9R5N4
WP_015116813.1.44015 gi|427734238|ref|YP_007053782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]