SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734474|ref|YP_007054018.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734474|ref|YP_007054018.1|
Domain Number 1 Region: 255-459
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000338
Family Galacturonase 0.083
Further Details:      
 
Domain Number 2 Region: 18-211
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000145
Family Galacturonase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734474|ref|YP_007054018.1|
Sequence length 463
Comment hypothetical protein Riv7116_0892 [Rivularia sp. PCC 7116]
Sequence
MATATNDMNSGNGLEITSDTNLNGETFSNFKEDGIAVQEDGVSVELEQVEATKNGDDGFD
INGDVSNASVSAKNSTFNLNGDDGIDVFGEKNTVDLFRVEASFNEESGLELDGNNNNIKI
DTSEFEANRDGLNIPRTGVGNNIDIQDSAFFDNKDDGIDIFGNDNTFTLDRASSTGNVED
GLEIDGSKNKITGSNNNFSNNGGDGFSDDITASGNEITLNATTFRNNGDDGFDIEGSDNT
ITLKNVSSDGNAEEGFEIDGRNNKVTIQDRSVFGGNKEDGFDIDFRGTGNTVEVIESGFR
NNGDDGFDIFGRNNTVTWEDVQSFDNKEQGFEVDGDANTITIKDSFLLDNGSSGFSFDYT
GENNNLTINDSEILRNAEDGIEILGNQNTVSLSNVEIYDNGEWGLDIAGNENSITIGSST
FENNQSGAIVIGGDNNILEILAGTNLTADNIVDNGNNNTISFV
Download sequence
Identical sequences K9R7N8
WP_015117049.1.44015 gi|427734474|ref|YP_007054018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]