SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734624|ref|YP_007054168.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734624|ref|YP_007054168.1|
Domain Number 1 Region: 25-99
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00002
Family PDEase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734624|ref|YP_007054168.1|
Sequence length 313
Comment hypothetical protein Riv7116_1047 [Rivularia sp. PCC 7116]
Sequence
MFNATEVLIDAFVNRVREGYHRTYGSLKTDYQDIIAWVGSMALENIANSDALYHNVEHSI
LVTLVGQEVLRGKHIREGGVSSEDWLHFIISLLCHDIGYVKGVCRQDREEEGLYATGKNE
AMISLQPGASDASLTPYHVDRAKLFIDERFGGHKLIDSEVIKSNIELTRFPVPAAEDHQE
TKNYAGLVRSADLIGQLSDPRYLKKITSLFYEFEETGMNKILGYKNPADLRNNYPKFYWN
GVYPYIKDGLRYLSLTQQGKQIIANLYSNVFVVEHEKPQEKHVYLDNLEMREVGMKEFSE
KKSNTVKARTRVS
Download sequence
Identical sequences K9R849
WP_015117199.1.44015 gi|427734624|ref|YP_007054168.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]