SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734721|ref|YP_007054265.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427734721|ref|YP_007054265.1|
Domain Number - Region: 14-147
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00753
Family Tryptophan biosynthesis enzymes 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734721|ref|YP_007054265.1|
Sequence length 856
Comment collagenase-like protease [Rivularia sp. PCC 7116]
Sequence
MTTNSPQIPELLAPAGNWECAKAAVENGADAIYFGLDKFNARMRAENFTEADLPELMQFL
HLRGVKGYVTLNTLIFPQELKQAQRYIKSIIAAGVDAVIVQDVGICRLIRHISPDFPIHT
STQMTVTSAIGVEFAKELGCNLVVLARECSIKEINKIQQQTQESSLPLEVFVHGALCVAY
SGQCLTSEALGGRSANRGECAQACRMTYELIADGETINLGDRKYLLSPQDLAGLDVLPDL
VKSGVSCLKIEGRLKSPEYVANVTKVYREALDGLKVEIPPSPPYKRGEKKGEKKAPLLKG
GWGDREKYNLEMAFSRGIYTGWFEGINNQELVHARFGKKRGVYLGEVKSINKEKVTISCR
DVIHNVSIPIKPGDGVVFDCGHPEAKEEGGRIYGVENQGKDVVLSFGKGNLNWRRIHVGD
KLWKTSDPELDKQLRQSFAGDKPKLQRPIDIEVHGEVEGNLIAIARDEIGNLVKVESGIV
LVEAHNKPLTTERLTEQFGRLGNTPFYLKDVTNCINGGLMLPVSELNKMRREIVTKLEEL
RSQPKRWVINENASLKNLLPSIDSNSIISDSANLIVLVRNLNQLEAALKTEIKTIYCEFE
DPRKYREAVETVKKSSPPLSPSPNPPLLFVAPPRITKPSENWILQQVINSNADGYLIRNY
DHLKFFADERCIGDFSLNVANSLTADYFKNRFHLERLTASYDLNIHQLQDLLKTSPPDWY
EVTIHQHMPMFHMEHCVFCAFLSEGTDFRNCGRPCEEYEVKIKDRVGTEHVLQADAGCRN
TVFNGTPQTGAEYVHKLLDLGLQNFRIEFVNEKPEEVEQTIYRYQQLLNGEIKGSQLWRE
LNLQSQLGVTRGTVGN
Download sequence
Identical sequences K9R862
WP_015117296.1.44015 gi|427734721|ref|YP_007054265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]