SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734871|ref|YP_007054415.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427734871|ref|YP_007054415.1|
Domain Number 1 Region: 444-608
Classification Level Classification E-value
Superfamily beta-Roll 1.02e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 282-445
Classification Level Classification E-value
Superfamily beta-Roll 9.1e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 120-283
Classification Level Classification E-value
Superfamily beta-Roll 7.43e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0021
Further Details:      
 
Domain Number 4 Region: 587-776
Classification Level Classification E-value
Superfamily beta-Roll 2.72e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 5 Region: 3-97
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000379
Family Serralysin-like metalloprotease, C-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427734871|ref|YP_007054415.1|
Sequence length 1503
Comment putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MQNSFTGTTGNDNITGTSGDDLIEALGGNDSLSGLAGNDSLDGGDGDDFLNPGTGVDTVD
GGAGNDGLLLDLSTQATDLTINFTNATDGTVSNGTSFQNIESFNLETGSGDDTVTTDSDT
GNALVRTGSGNDNIQTGAGEDRVEGGDGDDTIRGGAGDDSNRRLNSYPGDTEFSGLFGGN
GNDVIFGEAGNDHLFGEAGNDSLDGGDGDDFLNPGTGVDTVDGGVGNDGLLLDLSAQATD
LTINFTNATDGTVSNGTSFQNIESFNLETGSGDDTVTTDSDTGNALVRTGSGNDNIQTGA
GEDRVEGGDGDDTIRGGAGDDSNRRLNSYPGDTEFSGLFGGNGNDVIFGEAGNDHLFGEA
GNDSLDGGDGDDFLNPGTGVDTVDGGAGNDGLLLNLSAQATDLTINFTNATDGTVSNGTN
FQNIENFNLETGSGDDTVTTDSDTGNALVRTGSGNDNIQTGAGNDKVEGGDGDDTIRGGA
GDDSNSVFSSYPGTFGRGGLFGGNGNDVIFGEAGNDGLYGEAGNDSLDGGDGDDFLNPGT
GVDTVDGGAGNDGLLLDLSASATDISINFTNATDGTVSNGTSFQNIESFNFSTGSGDDTV
TTDSDTGSALVRTGSGNDNIQTGAANDKVEGGDGDDTIRGGAGDDSNGIFSSYPGAFGRG
GLFGGNGNDVIFGEAGNDDLFGEAGNDTLSGVDDNSLTPGIGERDELSGGTGNDLFILGD
SINTYYDDLDTSTNGDNDYATITDFNPSEDKAQLQGTASNYRLEVDGADTNLYIQKPGNE
PDELIAVFENVTNLDLESDAFIFVEQQNQAPVLATNDGLTVDEDAIANITSTQLQVTDAD
NTAAEITYVITDVTDNGDLLLDGTTLALNDTFSQADIDNNLLTYDHDGSETTSDSFNFVV
ADGAGGNISSSMFDITVNPVNDAPVAVNDTATTDEDNSVTISVLANDTDAENNNLSITNV
SNATGTVTINGSNIVYNPDGQFESLNAGETATDTFTYSIDDGEGGTDTATVNVTINGLEQ
ANLPLVTVNNTAVSNPVISYGGPSQDVVGTAQVSPSNQLNLTGNRWQRVEINSNITANTV
LSFEFEGNGKSEVQGIGFDNDNSISRSNDGGQFFQVDGSQNWGITNLTQFIVNQSGNKDT
YEIPVGEFFTGNFDFLTFGNDDDQNNPDAEATFSNIELFEDNSLTVSINQVTENKEVESY
GGASQDVNVVQTINNTELQLAGNGWKRLDIMGYEINANTRLRFDFASNGEAEIQGIGFDN
DNSISRINDAGQFFQVDGSQEWGITNLSQFIVNQSGNKDTYEIPVGEFFTGNFDFLTFAN
DDDQTNPDAEAAFSNIELFEDNSDLLTVSIDEVTQNKEVKSYGGASQDVNVVQTINNTEL
QLAGNGWKRLDITGYEINANTRLQFDFASNGEAEIQGIGFDNDNSISRSNDAGQFFQVDG
SQNWGIEIDQSQYILGTTDGFTQYDIPVGDFFTGEFDFLTIGNDHDVANPTAVGQFQNIT
LIG
Download sequence
Identical sequences K9R8P0
gi|427734871|ref|YP_007054415.1| WP_015117445.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]