SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427734923|ref|YP_007054467.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427734923|ref|YP_007054467.1|
Domain Number - Region: 262-419
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0241
Family HD domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427734923|ref|YP_007054467.1|
Sequence length 464
Comment sensor protein/domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MLEGSILQRLQKAHQDSKRQIRYGVYYKNTLVALCHALEDHILDDDSEPLVITAFQQGKW
YLEEAERYADIAKCSRQIAIMAAPDSAWLEHPTSQLSNVDLVSIDPKDAVAEEWHLIILS
PKYTAMVICQELSEEDYGSLGQPESDLERKFYGLWTFEPDLVRETAQLAINHIQSYNPEL
AKKLHEYEQQINPTVAKSEELATVVSRVVDYLQTEQTNISVPAGNRHRILDRNLFSNEIQ
AFLRMAQLLDAADITNPMAATEVVALSETMGQLLDLPAWQIKRLRLAGFLHRIHPLQNAE
SVLTPVTSTKYKEDAPSCPLTCPLVPGTQVLRTMPRLRAVAQIITHQSEWWNGTGEPAGL
GGDEIPLESRILALVADFQSRVSQKFSSGLSKEETFTQALEECTQQQSTRFDPKLIETLT
LLVMGFHQGLELPVTSPKLSAGVWLVDSKQGGISEPSVIQSYLK
Download sequence
Identical sequences K9R7Q3
WP_015117497.1.44015 gi|427734923|ref|YP_007054467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]