SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735097|ref|YP_007054641.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735097|ref|YP_007054641.1|
Domain Number 1 Region: 17-112,165-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.29e-30
Family Pancreatic carboxypeptidases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427735097|ref|YP_007054641.1|
Sequence length 384
Comment putative deacylase [Rivularia sp. PCC 7116]
Sequence
MLPIISTIPLRQMASGDILSLQVYKFIGATPGKKVYIQSNLHGAEIVGNAVIHQLIEFLW
MLDNTDLIGEIWLLPVCNPMGTNQRSHHFSSGRYCVYEAKDWNRIFWDYEKDISQSNQSG
ENQLLTFAKSQINLDIEEIRINFLDAIKQQFVKLSDKVNSDSGVAYTEKFRYKLQSLSLD
ADYLIDIHSSTNQGLNYLYYFRDREESAKFFLLDFGILLDEYDGDAFDEAFIKPWLALEE
CFLQLGRTIKFDVEAWTLELGRGMEMIPDSVAKGVRGIKNYLKQKGVLSNDFQLDDIPQR
NHDMMFKTKSKVTKYYATVGGMINSRIALGREVRAGEQIYQILIFNKQGKLPTTVDIFAD
RDGFVYDVSANQSVNEGEFVLGIM
Download sequence
Identical sequences K9R9R1
WP_015117670.1.44015 gi|427735097|ref|YP_007054641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]