SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735163|ref|YP_007054707.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427735163|ref|YP_007054707.1|
Domain Number - Region: 61-95
Classification Level Classification E-value
Superfamily ACT-like 0.0708
Family IlvH-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735163|ref|YP_007054707.1|
Sequence length 239
Comment hypothetical protein Riv7116_1602 [Rivularia sp. PCC 7116]
Sequence
MASGLKTSTLELLKRFNKSFPQFYEQFVSSEIQLQNLRLAYRLYKTSRAVIELKPEGGKS
ALHFAYRNQSFLLSDIFGVLAAYGLTIHSLSLYGQIKPPMLVFMKLIVSRGSKALSEKTA
ENACRAIREALGGRFEVEEMLAVEFNLDAGLEKVETEFYVDPVFHLPALVIEADNQPGLF
YKVMYAMWLEDLLVVNANLLVWRGRTRLILYLLGPNESLIPEYLGHKIAESVRGRFLGR
Download sequence
Identical sequences K9R8C2
WP_015117736.1.44015 gi|427735163|ref|YP_007054707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]