SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735225|ref|YP_007054769.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735225|ref|YP_007054769.1|
Domain Number 1 Region: 248-377
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000114
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 4362-4451
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000497
Family Cadherin 0.033
Further Details:      
 
Domain Number 3 Region: 4546-4635
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000144
Family Cadherin 0.052
Further Details:      
 
Domain Number 4 Region: 4270-4356
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000157
Family Cadherin 0.03
Further Details:      
 
Domain Number 5 Region: 4453-4539
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000353
Family Cadherin 0.019
Further Details:      
 
Domain Number 6 Region: 4638-4723
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000759
Family Cadherin 0.034
Further Details:      
 
Domain Number 7 Region: 3967-4063
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.00000000301
Family Hypothetical protein PA1324 0.017
Further Details:      
 
Domain Number 8 Region: 1213-1298
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000457
Family Cadherin 0.013
Further Details:      
 
Domain Number 9 Region: 403-506
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000851
Family Cadherin 0.0077
Further Details:      
 
Domain Number 10 Region: 4175-4263
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.02
Further Details:      
 
Domain Number 11 Region: 4084-4174
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000738
Family Cadherin 0.039
Further Details:      
 
Domain Number 12 Region: 618-702
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000144
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 518-606
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.014
Further Details:      
 
Domain Number 14 Region: 3659-3748
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000345
Family Cadherin 0.025
Further Details:      
 
Weak hits

Sequence:  gi|427735225|ref|YP_007054769.1|
Domain Number - Region: 1304-1362
Classification Level Classification E-value
Superfamily Cadherin-like 0.000144
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735225|ref|YP_007054769.1|
Sequence length 6379
Comment RHS repeat-associated core domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MENLDFNQFNLSEQSDFYTVPNFSSLKPPFLLNIQNEQEFHPSLLDFGENINNSELPIYS
FTSTPITAIPSSSVQDINSLPANLLLEDSFVVNAEAINFSLSSSSSDFDDSISQAILQVQ
NSLSQFLEKSDSLQQLQLAFGDTWEPETANGLIKDLKDNHNFPSIELIDSKQFSARGAFS
AETNSIYLDKQFLEQNKSNINAISAVIEEEIGHYLDAKLNLTDSNGDEGKIFALLVQGVE
LTAEKIQQLKAENDWTILNINGQNLWVEQSSNEIVGTPGRDILQGTPEDDRIIGGFAGDI
IFGNDGKDTFVYQTIRDAGDVIKDFEIQKDIIDFTGVLNSFGYSGLNPIGDGYIQFSSYA
TGTTILIDSDGTGGRLTARPYLKVEAVTAEQLSTYPAHFLPVDNLPQNQVPTDLFVIPAN
IPENAPGNSVIGTFNTVDSDVGDSHSYSLIAGEGDTDNNAFSIVDNELQINQSPNFETKS
NYSILVRTTDQGGLFFDKSINITVSDVNEAPTVLNISNENIAENNLADAVIGTFTTTDVD
ISDSHTYNLINGEGDTDNNAFSIVDNQLQINDSTDFETQSNYSIRVQTIDAGGLSYEQIF
SIAVSDVNEAPTVLNISNENIAENNLADAVIGTFTTTDADISDSHTYNLINGEGDKDNNA
FTIVENQLQINDSTDFETQSNYSIRVQTIDAGGLSYEQIFSLSVTNVNEAPIITLPGEQS
VDEFTSSTISGISIDDVDAGQNQFTVTIYSDNGTVGITPIQGVTVTETGRNLTLSGILAD
INTALTNLTYKGDPNFSGSDIITVIANDLGSTGTGGDNQVISTIPITVNSINLPPVADED
KLLTVQQNSDAISLGIAAPTDPDDDSLTITVEEIPAVDKGAVKLGDSLVIVGQSLTLAEL
AALVFVPVADTTGDAGQFSYIVDDGQGGSDSQTVNFNISPVIILREGEDFKVVREEEITI
PATPSLLSFSYEALNFDTTDNNFINDAFEVALLDENGKTLVHTIGNNKDVFFNFTEEQSP
LLAPGVTLEGQIINLDLSHIPSGTAATVVFRLVNNDSDTETSVIINNLEIIPNPTPGNTG
AIPTITNSGSNSIDILQLSDVSASTKAQYQQTSFNEQRNILTAEVAIENTGSYGLNGRLI
VAINQLSDPSIKVVNADGLTPDGLPYYDFTDLITGGNLDPGDLTKTKTITFANPNQIQFD
YELVVLSEINENPIIKSNPNLEVIGGLNYVYDVNATDANGDTLTYELLISPEGMTIDADT
GIITWNTAVADIANHQIFIQVSDGRGGFAQQDFTLATISAPPNRPPLFTSNPVVDAYINQ
LYQYDADAIDPDLDLLNYSLILGPEGMNINPNTGLIEWEPKPVFTLGDTVLGQLSIPGET
DEFTFSGVIGQQIYFDPLQYGGNYWDWNFEVYSPSGKQIVSTNLQSSSNQLVTLTETGNY
RIVVDADNDVTGNYGFSVIDLNLTPIAALDTVIEGQLSPGSEDDVYRFTGNAGQKLFFDR
LNSSGNWNWLLYDPGNDVVASNSFSDMELYLPTDGEYKLVIRGTGNLTDITPYAFEIITP
DEITTAITLGNNDNPNSVFGEITEKGEEDFYTFNGSVGQIIYFDRLFLDSTSSLSHTFTI
ISPSGDSVFSQNFNSNDSSTPIFLPENGTYRVRIDASGENTGSYSFNLLDVGLATAIDLD
AEYSGTLDVGQETHLYQFEGIKGQRIFIDSPGVISGGTWTVYNSANKQIVNTSIGSDIEI
VLDSTDTYILAIKGNNGTNQVDYNFQIITPDIITEPLVLDTDVVSEITEKGEQDIYTFTG
SLGQRLFLDTLIDRWDFQATLISPSGEKIVNSIRMYFDGSNSTTPVILPEAGTYQLIIDG
SGEATGEYGFSLIDVSAAPVLEVETLTAGVLDPGKSIQFYQFSGNKGDRIYFDNQANSSG
ATWYLFNTNSNRLRSASLGSDFEYVLSGDDTYYLMLSGESDTTVDYNIQIVNTTAVSTPM
TLNGTVNGEIAKLGEQDIHTFAGTVGQTLYFDPRIANNNFTVTINSPSGQQVWSGNGSSD
SIPVTLTEPGTYQLIVDGNNDNTGEYSFVLSDAASALVFDTALNGNLDARETVLYQFNGT
GGQQLEFDSLSNVSGADWVIYAPTKLLNKSNKTVASSALSSDFKVTLPVDGSYILALRNN
SDSNFSYQLQVNDVSTAPVISSDIETLREGSISVAGEIDTYNFTANAGTLIYFDGQQGGF
NFYARLGNPDGTRISTSTLYTGSDSGAYLLTQTGDYSLEVVANGNNSTEDYRFKLVDLKA
SPVFDLNTPANVTINPLETKAFKFTGTVGQKLWFDGLNASNTNITVSLINSSGYQIASTS
SLQNDIELKNLEADGEYYLVLQSNNTDVTTASFQVLDNINATFIDLDTEITGNFGDSKQQ
THLYRFNATKGQKLYFDQIERDRYNYYYLYNPAGERLFSRQLLSDEEITLPTDGEYTLVF
AGSNSASNNNYTLKIVTPEFTTTPLSMGETINDEIGEAGEEDTYTFEGTVGQKLWLDELL
GNSNITATLYSPSGNQVFSSSFGNRDDSYWRPPILEETGTYKLVVDGSLDATQAYSFRLL
DFADATPIDLDTEITGNFGDSNQQTHLYRFNGSKGQQLYFDQIEGDRYNYYYLYNPAGER
LFSQFLDRDRQEITLPTDGEYTLVFAGDNSASNNNYALKIVTPEFTTTPLSMGETINDEI
GEAGEEDTYNFEGTIGQKLWLDELLGNSNITATLYSPSDNQVFSSSFGNRDDSYWRPPIL
EETGTYKLVVDGSEDTTGAYSFRLLDFADATPIDLDTEITGNFGDSNQQTHLYRFNGSKG
QQLYFDQIEGDRYNYYYLYNPAGERLFSQFLDRDRQEITLPTDGEYTLVFAGDNSASNNN
YALKIVTPEFTTATLSIGETINGEISEAGEEDTYTFEGTIGQKLWLDELIGNSNIKATLY
SPSGNQVFSSSFGNRDDSYLRPPVLEENGIYKLVVDGSLDATQAYSFRLLDFADATPIDL
DTEITGNFGDSNQQTHLYRFNATKGQQLYFDQIEGDRYNYYYLYNPAGERLFSQFLDRDR
QEITLPTDGEYTLAFAGDNSGSNNNYALKIVTSEFTTTPLTLGETISSEISELGEEDTYT
FEGTVGQQLFFDSLVGNFNLDARLYSPSGNLIADLRTDLDGTPFTLTEAGNYRLVIDGNS
DTVGNYSFRLSDRAQVTPLELSSAISGSLESGNEVDLYQITGTRGTILNFNLDAAAWSGA
NWVLYDPDNGILAQPSSNNPDFEVALPSDGLYTLAIVGNGTTAVNYSFQVTDNSVAPIPI
TGTNVTVSGTVANVGDVDSYTFAASAGTLIWLDQLSNTSSSILANLKNPDGSYVFENRGT
DNDFGVIRLDQTGEYTIETFGASSSTTGNWQFQILELISDPRSSSFNPQPFNAVREDSLD
SETSTKIYQIDAIVGQKLLFNGMRGDVNVDLINPNGEQVFNWNNFDSNNSIIPTLTQDGI
YYLVISGNSGGNLDYAFQLINLASGPELPVNVPVSGNLASGQQSTLYQLTGKADQKLFFD
IKDGSTSAQIKVYSPNHEDVLYSTFLDSSYSFELTLPEDGFYTVLIEGGSSTTSINYEFQ
VFAPNTDLVGIVTPGNGTRNDTDNTLGEFAVQIAVEDGQGGKTLQDFSINLLPDPDNNAP
TIISTPQTRAALDREFYRYQLQSLDPDGDSLLYRLVEAPSGALIDNSTGELLWFLDESVA
AGETYDFKVEVGDGRGGVDTQNFQVDVFSELGTIQGFAFDDLNQNGIFDLDLIQGDTPDV
FFVIEYSCAVSGGVVDWTTADLETAFSGNLTPVDQELGAILLLNNYLIEQGFGETANIGI
LDGTGEVFDMDPSRPGIQVATNPLADNNNNGIADIREALRRPLYGSSPNAVVKAIDLHEG
LGLTGDLNVMFMSSGNFTLKEEDTTAIDAAKAEGVNVSAFSFSLRAMEKMRAIDPEATLI
KSTQQVYDIFSGNVLGENFDPKFIAEPLLENVTVYLDLNNNSVLDPEEPKQITKQPGENG
NYYYSFDNLLPGDYTVRQVVPENYFETTPASGSFVDTVSATDNTFTHAFGIARKDNNSLV
NQNPVFTSTPPTERLEVGEKFIYQALATDADLDSLTFDLSLAPEGMIVDAELGLVLWQPT
QEQIGIPGTLLRVQDGEGGFATQYFELNVTPLNNAPVFTSIVPENATPQVGKPFQYQAQA
IDPDGDRLTYELVNALSNITIDTATGLVNWTPDSTEIGDRQFQVKVSDGNGGEDVQELNF
NVIETIPNNAPEITSNPPIKARANNLYVYQVGAEDIDGDPFSFNLNNAPDGMTIDERGRI
TWNPDVSQLGEHTVEVTVEDGQGGIASQSFNLNVSNRVANQAPSITSIPNTITNTERLYQ
YQPQATDPDNDYLLWNLDQAPQGLVIDSESGILSWQPKTNQIGSHNIAIRVTDTFGQAEI
QTFELQVTGNNTPPAIISTPNTIAASTQLYSYQIAANDPENDPLRYSLGIRPQGMIVEES
TGLIQWTPQTGQTGENTVEIFVEDTQGGISSQTYTLVVGTNAVNQAPTITSNPGFLADVE
NGYSYQIQATDPDNDPITFQLLSNPEGMTVDANTGLIQWSPQSGQIGNAQVSVAAFDDNG
LGAIQTYTIKVQQSNSEPVINSNPIESAAPGITYRYDINANDPDGELLTYTLTQAPQGME
IDQLGRISWLAGNDNLGINPVEITVSDGRGATVTQTYDINVAADEIAPQIELILNQETVN
IGDSVKVLISATDNVGVDTINLTFNGNPIALDAQNQATITVEQAGNFEILATAKDLAGNI
GTATANAIGIDNSDVNPPVISITSLENGDVVTAITDIIGTVTDDNLVYYTLSLASQDGSF
TEIFRGTDNITDDVLGKFDPSNLSNDSYTLRLSAVDAGGNQSVVDIAVEVAGELKVGNFQ
LSFTDLSIPVAGIPIILNRTYDTLNANSSDDFGYGWRMGIQDTDLRTSVAETGSEENLIY
NPFFTGARVYVTTPGGKREGFTFKPQLAPGFKGSFLGMWEPVFVPDAGVTSELTVEHFDL
SRTNTGDFTSFGSSLAYNPSNPAFGGTFTLATKEGVIYEIDGNSGDTKTVSDRNGNKLTF
TDAGIISSSGQQITFERNSQGQITAAIDPSGQRIEYEYNTTGDLISVTDREGNVTRFDYD
ETRPHYLEEVIDPLGRSGVRSEYDDQGRLVKIIDADGIPVELIHNPDNFVETVKDQLGNE
TVFEYDNRGNVINQIDALGGLTERTYDENNNVLTETDPLGNTTTFIYDNRGNVLTETDAL
GSVTRFTYDSFGNVLTATDSQGNTTSNTYDRNGNLTSISGQANGTTNLNYDASGNLTSFG
DANGTTTFEYDASGNVTRQIDTEGNETTFTYDANGNQLSETKTLTTPEGVITLTTTTEYD
AEGRVTKVTDAQGGVTQTRYDAVGNQIEQIDALGRSTKFVYDERGLLVETIYADSTPEDD
SDNSRTKTEYDAAGQVIAEIDELGRKTQFKYDKLGRVVETILPDSTPDDDSDNPSTKTEY
DAAGQVIAEIDESGNRTQFVYDKAGRQIETILPDETPLDNSDNPRFTTTYNAAGRQISQT
DAKGNVTEFLYDDLGRPVGQKFADGTTVNSQFDETGRLIARTDQDGEITRYEYDTSGRLT
AVIDALEQRTEYDYNEQGNLVSQKDANGNITKFEYDSLGRRIATELPEGQRYTTEYDAIG
NVIRTTDFNGESITYEYDDRNQLIAKNFPDGSTTTFTYTLNGQRETVVDEHGTTTYEYDA
QNRLIKRIDADGTEIAYTYDAAGNRTAVNIPSGTSDYTFDELNRLQTVTDADGGITTYEY
DNNSNLIRTQSANGTVENRVYDNLNRLTYIETKDINGDIISSFLYELDAEGNRTQVTEHN
GRIVKYYYDDLDRLQKEEIFNPTATAATRTIEYTYDAVGNRLSRDDSGEGTTIYTYDNND
LLLSETTNGTETTYTYDNNGNTITKSTDGNTVTYNWDEENRLVGADTDGDGTVDVENQYD
ADGVRIAQTVNGEQTRFLIDNNRPYAQVLEEYTEGGIIKVSYVHGNDLISQERNGEKSFY
HVDGLGSTRALSNESGNANDSYIYDAFGQVLTKIGDTENSYLYAGEQRDSNLGLDYLRAR
YLDVNSGRFVSRDSFEGNLLNPITLHKYQYTGNNPTNNIDPTGMFTIASMLSVSIPEVDF
RVAYSKATIRGGVHASKTLLELLPQAMLLREKGLLAIANDISGGFELYQLGNEKFLEAIK
QVPKAFRESFGAAAKTLLPSVKINIFTSGSLVSPLLTGIDRARRVNNKIKQLNNTAEQWS
TRLEQYLGIPTPQSFKRLNTITKQFSQDIDAIIGEESISIGVVNINGAPNRGNLKSGITT
AEDKVTIKLPPFIYRNRSR
Download sequence
Identical sequences K9RAV3
WP_015117798.1.44015 gi|427735225|ref|YP_007054769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]