SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735417|ref|YP_007054961.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735417|ref|YP_007054961.1|
Domain Number 1 Region: 177-227
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000493
Family AraC type transcriptional activator 0.015
Further Details:      
 
Domain Number 2 Region: 229-276
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000151
Family AraC type transcriptional activator 0.031
Further Details:      
 
Domain Number 3 Region: 10-158
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000000798
Family Regulatory protein AraC 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735417|ref|YP_007054961.1|
Sequence length 285
Comment DNA-binding domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MINTNKVYQERRVWQPKHIDNIEIAYRDSSAFNLPAHFHEELEITLMQGSNWNFDYRGEK
FTVPPFSFTLTQPGETHKASFESDFNCRFYGLRVKADLLKQLAEEIKGNYQYLPFFSTPV
ASDKELSQLIFTFHVLVKNSKGSILKQQSLLLQIVEKLILRYTQDSSNLKYIGKENQSIQ
RVKDYLNDNYAKNISLEELARIANFSPFYLNRAFRKQVGIPPHKYQTQIRIARAKNLLNN
LSISQVAVKTGFSSQSHFGWHFKKVMGVTPKKYVKESNILIDANI
Download sequence
Identical sequences K9RAP0
gi|427735417|ref|YP_007054961.1| WP_015117990.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]