SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735749|ref|YP_007055293.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735749|ref|YP_007055293.1|
Domain Number 1 Region: 565-718
Classification Level Classification E-value
Superfamily beta-Roll 6.8e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00061
Further Details:      
 
Domain Number 2 Region: 264-418
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000606
Family Pancreatic lipase, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427735749|ref|YP_007055293.1|
Sequence length 725
Comment hypothetical protein Riv7116_2223 [Rivularia sp. PCC 7116]
Sequence
MNLQSLETNLKMNNNTASHHSLHKDVLSTDNYLGEHFRNHSLTGSSQSHPLSFEEDFSSE
VTDKVLISQFVDLKSEDLQPEAAFNETPISIEFIDGEIGKRISIPVFNDNLDGNSQVNLS
SKNSSKNFTDNTVIGNQNAAVTVAEESPYKNVNSFDTLPASDVNNLEINIQTVGDDTGHL
NDISLSQVEGNQYANHNGVASDETFDNQSILQTQSFQDATFNSQDKGEYLDPSVLPVQGT
ITGGSEEGILLNSEIENNPSIRNVGFREFNNPADAQQTWVIIHGWNDTPDGQFTELAQEI
AAANTGDRVLLLDWREAAYNADGINGIDLSALGKGNFRAASWIDPVAEFAVEALNDYYGI
DSLGASQSLNLIGHSLGSLVSAEIGRLYRDGLTVENETVVTGNNEGARTITALDPPSARN
RDENPLAVDPLEDIYDVDGRIEGIQTPQTFADTSVFSRAYVGEKSIAGNKVLALGADEAF
EMTFGTNSELTDFGREHTRVVSAFINTINQQGVLGDLLGLDAYQSLETMSIDDLGELQII
EGSDKGFKGIINVNEDNLVTSLAGILKAGNQDDIVIGSYTNEEMHGTDLLNFGADSPYAG
DHNDIFFGESGNDMILGDDNDDILIGGIGTDILNGGAGIDTFIFKPGDGGADKSSTNIIE
DFELGIDKIGLTDMSFDQLTFEESSNGTLIMAGSEIIAFLKNTKVQEIQNAEYFINVGEN
QFAVS
Download sequence
Identical sequences K9RBC2
gi|427735749|ref|YP_007055293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]