SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735834|ref|YP_007055378.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735834|ref|YP_007055378.1|
Domain Number 1 Region: 21-177,205-369
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.35e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 464-628
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000565
Family iota-carrageenase 0.087
Further Details:      
 
Domain Number 3 Region: 326-432
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000345
Family P22 tailspike protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735834|ref|YP_007055378.1|
Sequence length 820
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKGIAFLSGFITVFLTSGINLPAVAQVTSDNTTNTTVNTNGNNFNIINGIQKGNNLFHSF
KEFSIPNGGSATFNNSTDVTNIINRVTGGNVSNIDGLIKASGNANLFLINPSGIVFGENA
KLDIGGSFLGSTASSILFEDGFEFSAVNPQEKPLLTVSVPVGLQMGTNPGAIEVNGSGHN
LTARDANFAPYINPLSFIPSQLKPGLQVKPGNTLALLGGDIQLVGGILTAVEARVELASL
KQGRVSLVDTSKGFSLNNSKISDFGNIQLLSRALVDVSGAGEISVQGNQFNIKDGSVVGI
QNRGIQTAGNINVNAKSIDISGAISETQIRSSLVNETFAGDAGNINISTERLSIEDGAGV
FSRTFGFGNSGVININATESIDVIGVSSDPRNFSIISSVTFGQEDSGNINLSTGNLSVLN
SGVISTTTFGNGSAGNINVQSDNTLVFGLSRGFFGNTTITATSFGKGNSGNISINTQTLS
VKDGGNVNTSGYSSGNSGNVTVNATEFLEISGGKQMRGSNINSAVLSLPEFYRQLLTQPH
ATTGNAGNVTINTPRLKISDDSSILVRNAGTGNAGKLAITADLIQLENQGELVARSNSGR
GGDIFVQSDSLQMRRSGLITTDAKGEGNGGNITINTNTLVALENSDITANAQNSFGGKVT
VNAYGIFGTQFRENLTEESDITASSDLGAEFSGDVELNTPGIDPSSVTVELPENLTDSSN
QIASGCAAQTGNTFIVTGRGGIPTNPNLYSYSNPIWLDIRDLSAFRKPNNNSEITNISNK
PAIIEATSFIRNQDGEIELIASQNEPLTTQGFNCSGMNTL
Download sequence
Identical sequences K9RBM0
WP_015118406.1.44015 gi|427735834|ref|YP_007055378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]