SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735835|ref|YP_007055379.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735835|ref|YP_007055379.1|
Domain Number 1 Region: 21-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.018
Further Details:      
 
Domain Number 2 Region: 333-437
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000257
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number 3 Region: 439-567
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000148
Family P22 tailspike protein 0.047
Further Details:      
 
Weak hits

Sequence:  gi|427735835|ref|YP_007055379.1|
Domain Number - Region: 564-666
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0229
Family Filamentous hemagglutinin FhaB, secretion domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735835|ref|YP_007055379.1|
Sequence length 817
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKGIAFLSGFITVFLTSGIILPASSQVTSDNTTNTTVDTSNNNFNILNGIQKGNNLFHSF
KEFSIPTGSSATFDNSTDVVNIINRVTGGNTSNINGLIKANGNANLFLINPAGIVFGENA
RLNIGGSFFGSTAESILFEDGFEFSAVNRTDAPLLTVSVPVGLQMGTNSGEIQVQSTGHN
LSFSPNGFFPPFTREANPQALSVKPGKTIALVGGGITSTGGQIVAEGGRIELGSVSDGEV
KLNSISTGFALDYSNVSNFQDIQLAQKASLDASESDINGGIHLSGRRINVTDGSVGLVQN
SKAGIKGGNITVNASELLEFTGTTTDGKIRSNFTTETINTGASGEIRVSTKDLIFTDGGQ
IVTRTYSGGNSGNVTIDASESVQVIGSAALNPRFLSSIFLTVNGRTSTGKAGDLNISTKD
FIASDGGLISTASYGKGDGGNITLNADNIDLSSTDPVFDGSTDLRVGSFRGGDGGSLTIN
TQRLTVRDGARINATTIGEGNAGSVTINASKIVDVRNGTITSSATSPDLRTVLNGFDTDS
TGKAGSININTNRFIVRDESTISVANNGPTDAGELSINANSLFVDNQAILSANTKLGEGG
NIALNLKESLILRNNSLIDTEAGGTGNGGNITIYSPIIAGFENSDIVANALEGNGGNIDI
TTQGIFGLKFRDSLTEENDISASSQFGVNGTVAINNISIDPSSGLTELPVKLADSSQKIA
SGCAAKTGNTFVATGRGGIPQNPNEQVDTSNTWSDIRDLSAYRKPNNNSENTSISKKPAI
IEATGFIRNRNGEIELVALQNTPFNKQQASNCSGINT
Download sequence
Identical sequences K9RCN9
WP_015118407.1.44015 gi|427735835|ref|YP_007055379.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]