SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735836|ref|YP_007055380.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735836|ref|YP_007055380.1|
Domain Number 1 Region: 25-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.16e-50
Family Filamentous hemagglutinin FhaB, secretion domain 0.019
Further Details:      
 
Domain Number 2 Region: 441-524,559-586
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000502
Family iota-carrageenase 0.093
Further Details:      
 
Weak hits

Sequence:  gi|427735836|ref|YP_007055380.1|
Domain Number - Region: 365-436
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00141
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 
Domain Number - Region: 527-684
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0141
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427735836|ref|YP_007055380.1|
Sequence length 832
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKWIEVLSGFVSILITLGVVLPAASQVNSDETTNTTVSTSNNSFNILNGIQKGNNLFHSF
KEFSIPKGSSAVFNNSTEVVNIINRVTGGNISNINGLIKANGNANLFLINPAGIVFGENS
RLDIGGSFFGSTAESILFKDGFEFSAVNPQEKPLLTVSVPVGLQMGTNPGAIEVNGNGHS
LTTTNPYLVPYFPTAPIMGLQVKPGNTLALIGGSINLNGGILEAPGGNIELGSVNSKSLI
NVNPQDRKFSFDYSNTSNFGDIQLSSKSLVNVSGNSTSSIQFQAKNISFNNGSFIWSRNL
GIQPGGDITIQATELLELSGTTPDELIPSGIISETMGLGTSSNINVSTSGLIVQNGAAIN
SRTYTPAPGGSLTINATDFIQMKGSSPKTGLNNFLATATFFPTQQEKPIQTAKAGNITIS
TPSISMTDGSYISSTSNGDSSGGNIRINTNKLELTGFTFNSYFYFIPTAISGIAYLRGDS
SNITVQTDTLNLKDGAFISTSNVGSGNASDLEINASESINVEGFAQILDNENGVYFSNIS
STVGSSSALIQQNPNFPTTGDAGNVTIRTSLLKIGNQANVSVANYGDIGIAGRLKISADS
IQLNRGNIFASAFSGEGGNIDINLNKSFVARNNSLLNTESLGTGNGGNLTISSPVLAGFE
NSDIIANAVKGNGGNIDITTQGIFGLKFREQLTSKSDITASSEYGVNGRVNINNVGIDPG
SGLVELSAQLSEPSQQITSGCSSNGDSNFVVTGRGGIPRNPTHHLNSNPIWFDIGDLSAS
GARNNNAEVTTISNQPAIVEATSFIRNQDGEIELVATQPQSLNTNKVYSCSI
Download sequence
Identical sequences K9RBJ0
WP_015118408.1.44015 gi|427735836|ref|YP_007055380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]