SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427735964|ref|YP_007055508.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427735964|ref|YP_007055508.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.89e-83
Family Histidine biosynthesis enzymes 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427735964|ref|YP_007055508.1|
Sequence length 255
Comment imidazole glycerol phosphate synthase subunit HisF [Rivularia sp. PCC 7116]
Sequence
MLAKRILPCLDVKAGRVVKGVNFVDLKDAGDPVELAKVYDEAGADEIVFLDITATHEDRG
TIIDVVHRTAEQVFIPLTVGGGIQTLENVKELLRAGADKVSINSTAVRNPDFINQASKRF
GNQCIVVAIDAKRRSNTENPGWDVYVRGGRENTGLDAIDWAKEVEKRGAGELLVTSMDAD
GTQAGYDIELTRTIAAKVGIPVIASGGAGNCEHIYSAVTEGQAEAALLASLLHYGQLSVA
QIKNYLNDRKIPVRN
Download sequence
Identical sequences K9RBZ8
WP_015118535.1.44015 gi|427735964|ref|YP_007055508.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]