SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736011|ref|YP_007055555.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736011|ref|YP_007055555.1|
Domain Number 1 Region: 301-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.59e-45
Family Ribonuclease PH domain 1-like 0.00000803
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.34e-43
Family Ribonuclease PH domain 1-like 0.0000254
Further Details:      
 
Domain Number 3 Region: 460-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.63e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 4 Region: 143-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.28e-27
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 565-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 628-705
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.25e-16
Family Cold shock DNA-binding domain-like 0.00063
Further Details:      
 
Domain Number 7 Region: 236-329
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000136
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736011|ref|YP_007055555.1|
Sequence length 717
Comment polyribonucleotide nucleotidyltransferase [Rivularia sp. PCC 7116]
Sequence
MEEFEKSISFDGRDIRLKVGVLAPQAGGSVMIQSGDTAVLVTATRSRAREGIDFLPLTVD
YEERLYAAGRIPGGILRREGRPPEKAILTSRLIDRPMRPLFPSWLRDDLQIIAATLSVDE
QVPPDVLAVTGASIATLMAKIPFNGPMAAVRVGLVGDDFIINPTYAEITAGDLDLVVAGS
PDGVIMVEAGANQLPEQDIIEAIEFGYEAVQDLIQAQLDLIAELGIEIVSEEAPEVDTTL
ENFISDRATDKIKKVLSQFDFTKAERDDALDVIKEEISAAIEELSEEDPIRVAAMENSKA
LGNTFKSITKKLMRRQIVEDEVRVDGRKLDEVRPVSCQVSLLPKRVHGSGLFNRGLTQVL
SICTLGTPGDAQNLNDDLQSDQQKHYLHHYNFPPFSVGETKPLRAPGRREIGHGALAERA
ILSVLPPRSEFPYVLRVVSEVLSSNGSTSMGSVCASTLALMDAGVPIAKPVSGAAMGLIR
EADEVRVLTDIQGIEDFLGDMDFKVAGTDTGITALQMDMKITGLSLEVVAQAVHQAKSAR
LHILEKMLACIEKPREEMSPYAPRLLTIKIEPDMIGLVIGPGGKTIKGITEETGATVDIE
DDGTVTIAALDESKAKKARFIIQSMTRKLNEGDVYVGRVTRIIPIGAFVEFLPGKEGMIH
ISQLADYRVGKVEDEVAVSDEVIVKVREIDNKGRINLTRLGIHPEQAAAAREAASNA
Download sequence
Identical sequences K9RBZ5
WP_015118581.1.44015 gi|427736011|ref|YP_007055555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]