SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736136|ref|YP_007055680.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736136|ref|YP_007055680.1|
Domain Number 1 Region: 47-127
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.7e-16
Family FHA domain 0.0043
Further Details:      
 
Domain Number 2 Region: 261-437,490-656
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000884
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736136|ref|YP_007055680.1|
Sequence length 663
Comment FHA domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MSNNLEIHLSWEDPATGELREPSLSVPIAFGREFSQMPGELKGQRVSRMLLNSSEVSRYH
ALIDWEQGQLMVIDQNSVNGIYINANRQKSSVINSGDILKIGPYEITLSFTLNTPTPAST
PTPVSAPTPTNSTIQFNPATNLPDATLPPEAAATPLGSSFPPPIFQEEKVPVQALHATGL
RVDETDYLALGAGLGSYIWIDLLRIYGVNSEKIIALGLDKEPFARYKQLCLNSQIPLHER
LRSNSDSCPDNIWGWPSYGLREAWRDFGKGRLNDSFKYLWKVFAEPDYAETYTPRASNVF
DSIDREAKRIGWEQIYRYGRIRAIRKTDDGRYCVAYSRGRGDHAFYVARFLHLATGYPAI
QFLPDLQAYREKYRDFKSVVNAYEDHNHVYEQLERQGGKVLIRGRGIVASRIIQRIYEAR
RKNPKITVLHLMRSPKPKGNKFGKTQRIVKHHFEFQPFNWPKACWGGELRVMLENASPEQ
RKSLLSDWGGTTTADRQDWQLITEESLRDGWYKIEFGEVQSVERDSQNGGTLTRIKEKSS
NGQITINADFIVDATGLDAKVQATPLLEDLVERYSLPLNHLSRLVVANDFELVEMRNGKG
KMYAAGAITLGGPYAAVDSFLGLQYCALRTVDALATARTPGVKKLNAISSFRQWMKWVSN
QSP
Download sequence
Identical sequences K9RCC5
WP_015118706.1.44015 gi|427736136|ref|YP_007055680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]