SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736139|ref|YP_007055683.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736139|ref|YP_007055683.1|
Domain Number 1 Region: 409-547
Classification Level Classification E-value
Superfamily beta-Roll 6.28e-26
Family Serralysin-like metalloprotease, C-terminal domain 0.00047
Further Details:      
 
Domain Number 2 Region: 5-114,168-297
Classification Level Classification E-value
Superfamily beta-Roll 3.99e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.0028
Further Details:      
 
Domain Number 3 Region: 310-405
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000942
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736139|ref|YP_007055683.1|
Sequence length 551
Comment putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MGGIGNDVLSGGEGDDSINGGAGTDTLRETADTNFTLTNNQLESAATGTDTFENIERVAL
TGGDSANTINASAYSGRVTLSAKAGNDTLIGGIGNDVLSGGEGDDSINGGAGTDTLRETA
DTNFTLTNNQLESAATGTDTFENIERVALTGGDSANTINASAYSGRVTLSAKAGNDTLIG
GIGNDVLSGGEGDDSINGGAGTDTLRETADTNFTLTNNQLESAATGTDTFENIERVALTG
GDSANTIDASAYSGSAFLYGKAGNDTLIGGSGNDNLYGGEGDDSINGGAGTDTLRETGDV
DFNLTNTTLTGNGTDSFSNIERVALTGGDSANTIDASAYSGSAFLYGKAGNDTLIGGSGN
DNLYGGEGDDTIYGGEGTDTLRETADTNFTFINSNQLQSEATGNDSFKDIERVALTGGDS
NNTIDASEFSGSAFLYGKAGNDTLTGGSGNDFIKAGEDDDLISGGAGNDRLYGEGGNDIF
VLSSDMGKDTIYDFEDGVDKLDLSDNLTFDMLTITASGSNTNILQGNQTLATLINVDSAL
IDVNDFNTLNG
Download sequence
Identical sequences K9RCG4
gi|427736139|ref|YP_007055683.1| WP_015118709.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]