SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736140|ref|YP_007055684.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736140|ref|YP_007055684.1|
Domain Number 1 Region: 205-565,592-611
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-25
Family Galacturonase 0.068
Further Details:      
 
Domain Number 2 Region: 666-694,729-814
Classification Level Classification E-value
Superfamily beta-Roll 1.02e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 627-723
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000171
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 912-1032
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000000199
Family Serralysin-like metalloprotease, C-terminal domain 0.002
Further Details:      
 
Domain Number 5 Region: 808-890
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000011
Family Serralysin-like metalloprotease, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736140|ref|YP_007055684.1|
Sequence length 1036
Comment Cadherin domain-containing protein,putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MAATVLNPGDIAIVGYITNGSPDSFSFVPLVDLSAGTEIYFTDSGWKGNEFRDTEGTKKF
TVDNDIAAGTVIRSTEQSSDFTWENVSRSLNLSGSGDQIAAVQSNNLDSPLSSDFTAIYQ
VDYTGSFEDADTASTGNIITGLSEAENTAVLLNDTAKYAYFDFDAIPNGTREDWLATINN
PENWTFSDDGTTLPSGSIEVISEVSANNLVVTNTNDSGEGSLRQAIENANNLEDVDTITF
DASLSGETITLTSGELLVTDAVTIQGLGANQITISGNNSSRIFKIDNNDSGNQIDVTIDS
LSITGGQTPEGDDANDDGAGIWNRENLTLKNVVIRNNQAADDGGGIRNDGEITIIDSTVA
DNTSIGTSDTSGGGGLLNTIGASATVINSTFSNNEAKNGAGIRNDDNLTLINSTLSGNTA
SESGGGLANTINPNDFRNPASGGKATISNSTITNNTAEDSSGNGANSQVGGGIANFGIAT
VSNSIIAKNTNDDDFKNLVFGQSNSNGNNLIGNGEGVAAFTNGNNEDIVGTAAAPIDPLL
DVLKDNGGATQTHALLADSQAINAGSNTKLVGDSFDLDGDGNTTEQIPFEQRAEGFERIV
DSVVDIGAYEYSIGNTASQAPGITANQSFPIDENSKKGTFVGRVIATDPDSNTLSNWQII
DGNLDVDGDGKDAFAINSRTGNITVNDADDLDFENNPSFQLQLSVSDGTNTSNPATVTIN
LNDVAGSEINGTSENDRLNGSPEDDVIDGKEGNDFLYGYTGNDTLLGGSGNDNLYGGEGD
DSINGGDGTDTLRETADVDFNLTNTTLTGNGTDTFENIERVALTGGDSANTINASAYSGR
VTLSAKAGNDTLIGGIGNDVLSGGEGDDSINGGAGTDTLRETADTNFTLTNNQLESAATG
IDTFENIERVALTGGDSANTIDASAYSGSAFLYGKAGNDTLIGGSGNDVLSGGEGDDSIN
GGAGTDTLRETADTNFTLTNNQLESAATGTDTFENIERVALTGGDSANTINASAYSGRVT
LSAKAGNDTLIGWYWK
Download sequence
Identical sequences K9RDG3
WP_015118710.1.44015 gi|427736140|ref|YP_007055684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]