SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736248|ref|YP_007055792.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736248|ref|YP_007055792.1|
Domain Number 1 Region: 912-1061
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-34
Family Histidine kinase 0.0033
Further Details:      
 
Domain Number 2 Region: 385-515
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.26e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.064
Further Details:      
 
Domain Number 3 Region: 256-386
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.73e-22
Family Heme-binding PAS domain 0.084
Further Details:      
 
Domain Number 4 Region: 681-810
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.35e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.022
Further Details:      
 
Domain Number 5 Region: 146-262
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.77e-17
Family Heme-binding PAS domain 0.077
Further Details:      
 
Domain Number 6 Region: 832-912
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000353
Family Homodimeric domain of signal transducing histidine kinase 0.0041
Further Details:      
 
Domain Number 7 Region: 551-647
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000262
Family Heme-binding PAS domain 0.06
Further Details:      
 
Weak hits

Sequence:  gi|427736248|ref|YP_007055792.1|
Domain Number - Region: 71-174
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 0.0235
Family Prokaryotic type I DNA topoisomerase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736248|ref|YP_007055792.1|
Sequence length 1065
Comment PAS domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MLLISANFLATASLMPHGNCYLWKPGLVGLHMVSDAVIALSYFSIPITLLYILRQRADVP
FNGIFWLFAAFIIFCGTGHLIDIWTLWHPDYWISGYVRAMTAVVSFITAIVLTYLVPQIL
TLPTPEKLQAEIEEKKQKEQFLRSIYEGVTEAIFVVDTTKEGEFIYESINPVTEKLMGMT
SKQVEGKTMEQVLPHNLALLIRERYNQCLSTGRSITYEECLRFDDDSEYSWWLTNLKPIY
NQNSQIYRIVGTSVDITERKQAEARLRESERRFRAIFDSMYQFIGLLKPDGTLLEANQTA
LDFGGITKEDVVNCPFWENYWWTISPETQQQLQQAIKRAANGEFVRYEVDVLGAGNKVTT
IDFSLKPVFNDLGKVELLIPEGRDITEKKQIIEALQKSEERWNLALLGTGDGIFDWDLST
NEAFFSTQYKEMLGYADSEVENSYQGWRDLVHPEDIDLAEATWKAYINHEIPQYRAEFRL
RCQDGSYKWILARGMAQWNQDGEAIRMVGFHQDISERKAAQAEIVRLNQQLEARVKRRTA
QLEESNKYKDELIESQEIAKAEIQIYEDIVENIQIGLCIWQMDDINDITSFRLATINPVA
SQMLGVNIEDDIDKPIKECFPNLFDDEHIAIVEAYAEVVKSKQVKDFGEFAYGDDRVPNS
WFEVTAFPLPDNLVGVAFNNVGERKRMETALAENERLYRNVVNSVKEVVFQIAKTGIWTF
LSAAWADITGFAVEDNLLKTFTDFMYAEEDKLNSRELFESVISGKQEHFQYEFRILTKDE
NFRWLEIYAQIEHNSNGETLGVYGTLNDVTERKQVEAVLQARADELAQINLILLQTTGEL
EKRNQELDQFAYVTSHDLKAPLRAIANLSEWIEEDLQEALTPDTQKQMNLLRGRVYRMEA
LINGLLQYSRVGRMKTEPEKVAVAQLLEEIIDSIAPPQEFTIEIIGEMPTFRTAKIPLQQ
IFTNLIGNAVKHHNRSDGRIAISVLEQDKFYEFAIADDGKGIAEKYHDKIFVIFQTLESR
DKRENTGIGLAIVKRIIEEFGGKITLDSQLGKGTTFRFTWLKKRM
Download sequence
Identical sequences K9RBB0
gi|427736248|ref|YP_007055792.1| WP_015118815.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]