SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736266|ref|YP_007055810.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736266|ref|YP_007055810.1|
Domain Number 1 Region: 22-329
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.77e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.007
Further Details:      
 
Domain Number 2 Region: 789-888
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 728-821
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000126
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 4 Region: 1089-1196
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000267
Family P22 tailspike protein 0.049
Further Details:      
 
Weak hits

Sequence:  gi|427736266|ref|YP_007055810.1|
Domain Number - Region: 915-1045,1083-1108
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00195
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number - Region: 1417-1519
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0138
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 
Domain Number - Region: 394-579
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0377
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 
Domain Number - Region: 1280-1414
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0785
Family P22 tailspike protein 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736266|ref|YP_007055810.1|
Sequence length 1678
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MYSYSHCLLWGFSVALSLAPVIEAKAQLIPDNTLGKENSLVTPTKLLQRIDGGAIRGSNL
FHSFKEFNIENGKSVYFSNPNAIQNILTRVTGKNASAIFGKLGVLGNANLFLINPNGIIF
GENASLDISGSFSATTSSSILFDNGFEFSTTNLQAPPLLKVNITPGLQYPRSQQGDISSK
ANLTVGKDLNLIGKNLNLTGKLKAGRDLNLKAENNLQIRDSSEIPFVADASNNLLLQGAE
NVDIFALNHPDSGLFSGNDLILKSFNPVLGDARYFSGGNFRVEQLDGSLGNLQSPNDPII
RASGDVSFESYNGASLHILAGGSVNITGDVTIAGTDDENGLQEEVILSNGEELDIDGKNQ
ATLDIRAGINVTDDVTEIISENGEFIPIIPNTERVKSSSDIVLEGNIKVDSPDGLVFLTN
QYNENANLGDGNIQIQGNIETSSNSGNAGTIIVDASGNIEISSNIKADSLTAAGGNISLM
SGATISMIGADIDSQSNIDDVSTNPIEGGDIKLIAPAIILEDASRVTVGITGLGTGGNLI
VETDDIKIFDGSGLSSITNGIGDSGDINITTKRLIIDNSLPEINSISIDNINNYRTGIST
FVSRLPKDNSFNSDFFNSGEGGNINVNASEFIKLTGNKSGTFSPTLRSESLASATLDTGI
ISGTNGSGAAGNTNINTGQLIITNGAGIATSSISPASLTTIYPDLLSSLIDETIPNPQAD
AIIQTISDKLSKIPDAGDSGELTVNANKIELIGSSGLTAATFSSGNAGNLIINNTDQFIL
KDGAIVSTSTFSSGNAGDLQVTTDKLNVSNGSFIGAGTLKEGEGGKVSITAFDSVQIIGT
SNEDNENQVSSKITTTSETGATGNAGELIVDTKKLIIADGAEISASTESTLGGEIFLQGL
ESLVLSNGKISASSLDGEAGDIIINALDFVNILENSKIASEATGTGIAGFIEINTKNLNI
ADASVASVNSKQSAGYILVNADNVTINNLSRVTAETESGISGDIEFKNLQTLQLSGESLV
SATTIDGEAGDITINATDEVKIAQSSKIASGAIGKGEAGFLEIVTNNLNISDNSDAVVSS
AEEGDAGLISIKASNVNLTNKATISANTASGDGGDIELNNLKTLFLSQESFINATTQDGT
AGNIKINATDLVTVENNSKLASEAVGDGIAGNIDIVTNQLNLTDNSQANVSSQGNGSAGS
LLVKANNVFLRNTAEIAAKTNESGTDGHISLDILNNLELSNSLISASTINGEAGDIDINA
TNSVKLSDSSMIASEAKGTGVAGELRITTNQFTMTNSQANVSSRNNGVAGDILINANNLN
LFQDAKISATTESGEGGNITLNMMNNLSVNSSQITASTIDGIGGDLIINATESINLTGKG
GLLVQASNGGEAGFIEANTNQFDVLDNSEINVSSKLGQAGYLEIIANNLFLSEGKLTAET
GVGEGLESGNITLNIQDLLWMQNDSLISAEAFDIANGGNITINNPQGFVIGLTFENSDII
ANANQGNGGNIDITTQNIFGLGFRAQRTLKSDITASSKFGVNGEVTVNQLDENSAHQLIN
LPSTLVQNAKIKAGCAASAGNNFIIRGKGGLPQSPNDLFDGNTMLVELADLVVAAESASN
ISVENVNSTNIDNRENQIIEATGWVKDADGNLLFIAKGTSEDSAIYSASCQDFSATSK
Download sequence
Identical sequences K9RCQ3
gi|427736266|ref|YP_007055810.1| WP_015118833.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]