SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736297|ref|YP_007055841.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736297|ref|YP_007055841.1|
Domain Number 1 Region: 502-648
Classification Level Classification E-value
Superfamily beta-Roll 5.49e-16
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 136-395
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.000000019
Family Tricorn protease N-terminal domain 0.026
Further Details:      
 
Domain Number 3 Region: 439-505
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000889
Family Serralysin-like metalloprotease, C-terminal domain 0.0036
Further Details:      
 
Domain Number 4 Region: 19-194
Classification Level Classification E-value
Superfamily YWTD domain 0.00000011
Family YWTD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736297|ref|YP_007055841.1|
Sequence length 727
Comment putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MSNNNNVDRKFHSFNFTPELVKDINPGNGNSSPQELTVFNEKLFFSSSDGSSGEELWVSD
GTEAGTQLLNDISPGGDGSNPQDLTIFNEKLFFRASDSNNGVELWVSDGTEDGTQLIKDI
NPGENNSFPNNFVILDEKLFFTAQNNDNGNELWVSDGTEDGTQLLKDINPGQEDSEPTDI
TVFDGKLFFGASDGINGNELWVSDGTEDGTQLVKDITPGSDNSSPTGFTELNGKLYFGVN
NSELWVTDGTESGTQRIKDINTSPRTAFPGDITVFNNKLFFVADNGSTGPEVWVSDGTSE
GTQLLKDITPGFDVLTPGNFTVFNDKLFFTAFTGGESFELWVTDGTESGTQLFKDINPGF
NSSSPANLTVFNDKLFFTANDGTNGRELWVSDVTANGTQLVADINPGEGNSNPENLIVFD
GKLFFTADDGSNGRELWKLDLDKTNPVNLIEGTENDDDIQGTSGNDKISGKNGNDTIEGG
RGGDIIRGNAGDDVLAADRIDRFDDFDGENSELRGDNGNDTIYGGSKDELIGGGNDNDVL
FGKGGNDLVRGASGDDILNGGLGNDTLRGQDGIDTADYSDLTFDGVFGDIAGLDVNLSQN
SARHSSDNNALTWEDTLTTIENVTGTIGNDRFIGNQDDNLFDGKGEINQSVMPSAYRQTT
FTAQNGDEYQVTADVVEYSGNQSDFTILGSTDNFTVCGSEIGTDTLIDIEFLKFDDGLVA
VDDSLFV
Download sequence
Identical sequences K9RD64
gi|427736297|ref|YP_007055841.1| WP_015118863.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]