SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736390|ref|YP_007055934.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736390|ref|YP_007055934.1|
Domain Number 1 Region: 2-168,197-341
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0062
Further Details:      
 
Domain Number 2 Region: 323-448
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.31e-27
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|427736390|ref|YP_007055934.1|
Domain Number - Region: 141-196
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00512
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736390|ref|YP_007055934.1|
Sequence length 450
Comment NAD(FAD)-dependent dehydrogenase [Rivularia sp. PCC 7116]
Sequence
MVDLLIIGGSDAGISAALRAKELDQTVNVTIVVADSYPNFSICGIPFYLSGEVPDWRNLA
HRTAGEITQTGINLLLNHKAVSIDSQQKKVKVVNEENQENWLTYDKLVIGTGAVPVQPAI
DGLNQSGVFLLHSMADSFAVHQHLTSKKPQSVVIIGDGYIGLEMADALTHQGIKVTVVGR
SPSVMRTVDAGIGNLIAAKLQSHQVEVASSVEVNAIQQQDGQLVVFGTNNFHKNADMVIV
AVGVQPLTDLADSAGLKTGLRGAIQVNRKMGTNVPDIYAAGDCVETLHRLLNKYIYLPLG
TTAHKQGRIAGENAVGGNREFAGSLGTQVVKIFDMAVSRTGLRDSEAKDAGFDPLTVEFE
TWDHKVYYPGAKKLHILVTGDKQTRKLLGAQIAGHYQGEVAKRIDIFATAIFHDMKVEDI
SELDLSYTPPLSSPWDPVQMAAQAWVKQLA
Download sequence
Identical sequences K9RE93
gi|427736390|ref|YP_007055934.1| WP_015118955.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]