SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736415|ref|YP_007055959.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736415|ref|YP_007055959.1|
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000113
Family Tetracyclin repressor-like, N-terminal domain 0.0055
Further Details:      
 
Domain Number 2 Region: 91-173
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000477
Family Tetracyclin repressor-like, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736415|ref|YP_007055959.1|
Sequence length 217
Comment transcriptional regulator [Rivularia sp. PCC 7116]
Sequence
MPSQTFFNLPQMKRQNITNAAIAEFTNHSYESASISAIVNRAKIAKGSFYQYFKDKQDLY
LYLVDRALEARNAFIAEANLPSVQSGFFVFLRALFQTILEFQLANPDWSQILFRGPHYGD
VPFRKEVFKRTKADIIILIKKNIQEAIAQGQLKADLNPDFAAFMIVTLSSQLRYFIPFYL
GINVERLVKDSPNPPLDAIRKIIDDCIQILEQGMGGN
Download sequence
Identical sequences K9REB5
WP_015118980.1.44015 gi|427736415|ref|YP_007055959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]