SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736450|ref|YP_007055994.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736450|ref|YP_007055994.1|
Domain Number 1 Region: 26-309
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.47e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0085
Further Details:      
 
Domain Number 2 Region: 570-615,653-683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 444-565
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000107
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 4 Region: 680-732,775-800
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000439
Family P22 tailspike protein 0.087
Further Details:      
 
Weak hits

Sequence:  gi|427736450|ref|YP_007055994.1|
Domain Number - Region: 319-428
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000229
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427736450|ref|YP_007055994.1|
Sequence length 1085
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MYNNWQIALISAITIGSALIHPSAYANPQIIPDATLPNNSLVKVEGKINRIEGGTTAGGN
LFHSFQQFSIPKGQKAFFNNAIDINNIITRVTGNSISNINGYIRANGSANLFLINPNGII
FDRGARLDIGGSFIGSTADSIKFSDGSFFSATSPESPPLLKINLPVGLQFGSNQMGKISN
SGQLKVDSGNNITLIGNIIENRRALELNGGQISLAAISSEGLANLAKNGEFLSFESQSNN
INNLQSDAGSAIVKSPVIVQKDKAGNTGKIVIQAQDNLEIIRTSIKSSNGGDINLQAKKL
SVIDSIIETALNSKANDNGGDISILAESIKITDTRNQRGSTRISSQVLTNAKGNGGDIDI
TTNSLLIDNKARIYAGTRGKGNAGSVSINASDAIELLEGDIFSQVDNSGIGNSGNINIRS
NSLKLDGGEGNRALINTNVKAKGSGIAGTIFIDVKDKIELRNGGRIVSNLEKKGDGSGGN
IFINARSLFLERGGRIQALTQGSGRAGNIDVRADESISISGNPEYTSSAGIYTSSEATAG
GEGGNINLIANKLKISDNAVLNARSRSSFPGGNITVEVDSLEMTDGGQILTTAFAEGNAG
NIEINARENISISGSDSSYFNRQIKLFKQKRNADSLVANDTPSSGLLARNTGISDGGKIV
INTEKITVRDGGVLSSESTGKGNSGNIKIDANFIELIDGGQIITNSKDSGNAGNIILNAD
KTDATQILISGSDPNYLQKFTQASELVEQGVFDEINQIIPNDTSNSALLAKTQGSGNAGS
LTLNAQQLQIANQAEIAASTSKKSTGIGGSIVFNVGELNIDNDAQVAVSSNGTGNAGNIN
INARSIGLNNNALLTANTQSAKVDSEIEQATININSKQLIMRRGSNITTNAKGENVIGGN
INIETDIIAALENSDISANSENFRGGNVIIRTQGIFGTQFRPQSTLNSDITATGATEDSS
GNVEIITPDIDLNLNSIELSEVPVESKIAQACTPRGRQNASTFIATGRGGLPLSPNQPVR
KRAVIANWIDLPSQNRIEVVRNSKQEVERKTIVEAQKFVVDKNGDVLLVAESEEGGYRNS
EFNCG
Download sequence
Identical sequences K9RED5
WP_015119015.1.44015 gi|427736450|ref|YP_007055994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]