SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736464|ref|YP_007056008.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736464|ref|YP_007056008.1|
Domain Number 1 Region: 14-521
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 1.01e-116
Family Amidase signature (AS) enzymes 0.0000000776
Further Details:      
 
Domain Number 2 Region: 617-727
Classification Level Classification E-value
Superfamily beta-Roll 3.01e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 539-634
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000123
Family Serralysin-like metalloprotease, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736464|ref|YP_007056008.1|
Sequence length 738
Comment amidase [Rivularia sp. PCC 7116]
Sequence
MPSTFNLSAPSTFNLQEATVSDIQKAYSFGVLSVEELTQLYLNRITAYDDQGPAISAVIS
VNPDALDKARELDAKLRNQGADGALYGIPVLLKDNYDTSDLPTTAGSDVLAGSIPPDDAF
TTSEFRDAGAIILGKTNMSEFALSSGRLGYSSKGGLTLNPYNLNRDASGSSSGTGAAIAA
NFATLGTGTDTAGSVRGPSAVTGLVGIKPTRGLVSADGIVPLALTVDYAGPMALSVEDAA
IALGVMAGVDENDPATEASKGKGFDDYTQFLDKNALKGARIGVAREYFGGNEEVDKLVEA
AIDNMRAAGATVVELDLPDSVVDASNYGTLLNTVIQAEFNPQIEEYFETLDEEYPENLEE
LIAASKDPELVNSETPVNPNRIAVYEDSLEFGGLDNPEYQAAINEGIPQLQKELNNIFAS
NKLDAIVYPTIATPATPITDSDGNVIEDPTYQANLDNIGGDPYRANYLGNLSGFPDLTLP
VGYTEQGLPVGMSLFGQEFTEPTLIGLAYAYEQQNPVRIPPSNTPALPGEKFEYLTEVLV
VGDAGDDVLETQLIPDFDGNKDVVFAGFGDDLVDTTQSISGGNRVFGGSGDDELFAGKND
RVNGGAGNDILDASLGRGGNRLSGGDGDDTFFAGGNDRLIGGKGNDRFFIIEKGGNTISG
GAGKDQFWIVNAELPEEVNTITDFESGVDVIGISGIGTFEDVSLEMNGKNTVINVLNQDV
AVVLGMQGLGESDFAFVN
Download sequence
Identical sequences K9RDB8
WP_015119029.1.44015 gi|427736464|ref|YP_007056008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]