SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736536|ref|YP_007056080.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736536|ref|YP_007056080.1|
Domain Number 1 Region: 47-155,209-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.96e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0089
Further Details:      
 
Domain Number 2 Region: 408-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000408
Family P22 tailspike protein 0.076
Further Details:      
 
Domain Number 3 Region: 573-689
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000273
Family P22 tailspike protein 0.058
Further Details:      
 
Domain Number 4 Region: 667-765
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000534
Family P22 tailspike protein 0.074
Further Details:      
 
Weak hits

Sequence:  gi|427736536|ref|YP_007056080.1|
Domain Number - Region: 770-815,846-871
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00879
Family P22 tailspike protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736536|ref|YP_007056080.1|
Sequence length 1081
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKGIYWLGLSIAAFQAFLISPCFAQSSNIVPDNSLDAESSQVTENFQGLPVERITGGAER
GINLFHSFREFNVSEERGAYFFSPNAEIQNILTRVTGRNPSEILGTLGTFGNSQPNLFLI
NPNGIVFGENASLDVGGSFVASTANGINLGETGLFSATEPTTSNLLSVNPSALFFNAVNN
QAEIVNRSRATSTVLGIAENGDANRPINGLQVLDGKSLLLVGGGVSLDGGRLLALGGRVE
LGGLAAPGNVNLLSEGDNLKLGFPENVARADVSLTNQAFMRVEANGGGDIAINARNLDIL
QGSKLSAGIGQGLGTPETVAGDITLNAAGEIKVAGAGSNVRNAVRSGSQGKGGNIIIDSD
SFLLEDSAQLIASTLGIGNPGNVKVTAADAVSLVDAVILSTVEADGEAQAGNIDINAATL
SLTEGAQMLTLTRGASDSQPAGRGDAGNVNVKVTGLVDIAGEKNGFFSGISSSVEIGSQG
NGGNITIDSGSFSLRDGAQLIASTFGQGDAGNVIVSAKDTISVAGATIFSAVEAGSVGQG
GNIDINAATLSLTEGAQLLAINRNAFDTQSVGSGNAGNVNVKVTGLVDIAGEKNGFLSGI
FSSVEAGSRGNGGNITIDSGSFSLRDGAQLVASTFGQGDAGNFKVTATDAVSVAGNAGIF
STVEAGSVGKGGDIDINATTLSLTEGAQLLTITREASDTQSAGQGNAGNVNVKVTGSVNI
AGVKNGFPSGISSLVNTGTKGNGGNITIDSSSFSLRDGALIDAGTRNDDKGGDIRVNTDI
FEALKGGQLITTTSSNGSAGKITINAIQKAIVNGSYPNFNNLVAQQGDSVRNIGANSGLF
VSSSGSGDTGDIEVNSPQITLDNQGKLNANSASGNGGNINLTSDLLLMRRSAQISTNAGT
AQQGGDGGNIDINSKFIVALPQENSDITANAFSGTGGNVDILSQGIFGIEPRQKESDLTS
DITASSDLGVPGVLNLTDPDDSNIRNNLDDLPDNQIDTDALIANSCISRSTKRQENSFTI
TGSGGLRKSPGDELVSQYSTGKVRSVESTSRTWKKGDRIVEPTGVYKLSDGKVLLSRGCN
S
Download sequence
Identical sequences K9RDH1
WP_015119101.1.44015 gi|427736536|ref|YP_007056080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]