SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736537|ref|YP_007056081.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736537|ref|YP_007056081.1|
Domain Number 1 Region: 55-380
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.02e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.014
Further Details:      
 
Domain Number 2 Region: 603-768
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000022
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 444-561
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 
Domain Number 4 Region: 797-888
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000251
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736537|ref|YP_007056081.1|
Sequence length 1168
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MKGIYWLGLGIALFQACLINPCFAQSSNIVPDNTLGAESSQVLENFQGLPVEIITGGAER
GINLFHSFQEFNVSEGRGTYFFSPNAEIQNILARVTGRNLSDVLGILGTLGGSQPNLFLI
NPNGIVFGENASLDVGGSFVASTANAIEFGKQGLFSASNPQTPGLLNVSPSALFFNAVAN
QKTNSIESQAFLTVPESKSLLLLGGNISPNTQSTGNIILNGGRLRAPGGRVEIAGLGESG
KVDLNHTKNQLSLGFPEDIKRVDVSLLNIAEIDVTAGGGGDISIYAQNLDILEGSDICAG
IGADESCGGLNLNNGSANAQAGDITLDATEKITIANPVSEVNNNVNSDAIGNSGNINIGG
KSIEINDGAIILAITFGKGNAGSINIFAEDTVSIKDSDGNNSFIANNIRNNAIGDSGGIN
ITTGSLFVNDGAQIKSLVYGKGNSGRITINARDQVSFDGRDTNDFPSSALTRVEVGAVGN
GGGIDINTNFLSITNRAQIASVTQGRGNASDISINAQSQVSLLNSDIITEVSEEGGIGIG
GDININTGALLLQDGSSLLADVENFGKAGNITINVGDRMVVEGEGLSALRNSTNIVPSQI
STTVESGAEGEGGNIDISANSLSIDDAGFISSRTAGKGNAGNIKLKARNEIIVKGIDSDG
MPSSINAIVGSNAVGDGGNIEISANSLSIEDGGFISSRTAGKGNAGSIKLKASNEIILKG
KDSADLPSAITATVGSNAVGDGGNIDITTGLLSLNDGGIISSDTSGDGKAGNLNIKTNNL
TLRNDARVSVSTFGKKDAGDLNIITDFLRLEDTSQFGTVTLSDGNAGTLRIKASEIIQLI
GSLDENRVQNGGLFASAIEGSGNGGDLILETDKLIVQDGATISASNFQSTNQRPPGTGSP
GNLNIDAGSVTLDNQGSITTATSVGSDENKGNISINIRDNLTATNSTISTTSEQSSGGAI
DITAQDIRLFGDSDIATNVFSGAGGGGNISLTANTIIALDDSDILSFARDGKGGDIKFNT
VGFFSKPLYRPNSPTTDTNANNAFNNNNQVDINASGTVSGAIAGVPDVTFIDNELTDLPD
NQIDTNALIANSCISRSTKRQENSFTITGSGGLRKSPGDELVSQYSTGEVRSVEPTSRTW
KKGDRIVEPTGVYQLSDGKILLSRGCSS
Download sequence
Identical sequences K9RDX7
WP_015119102.1.44015 gi|427736537|ref|YP_007056081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]