SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736543|ref|YP_007056087.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736543|ref|YP_007056087.1|
Domain Number 1 Region: 32-179,211-377
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.48e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.0075
Further Details:      
 
Domain Number 2 Region: 376-512
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000272
Family Filamentous hemagglutinin FhaB, secretion domain 0.066
Further Details:      
 
Domain Number 3 Region: 512-655
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000848
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number 4 Region: 931-1024
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000311
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 5 Region: 1024-1111
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000137
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 6 Region: 775-863
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000011
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 7 Region: 1175-1269
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000345
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 8 Region: 658-771
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 
Weak hits

Sequence:  gi|427736543|ref|YP_007056087.1|
Domain Number - Region: 1252-1407,1447-1453
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00502
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736543|ref|YP_007056087.1|
Sequence length 1501
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MPIKYSFYERLRFTLAGIAGCMGVFLITNSALAQQSNITPDNTLGRENSRLNRNVEIKGI
NADKIDGGARRNSNLFHSFSEFNINNGQAVYFANPDGVENILTRVTGGNQSNIFGTLGVD
GAANLFLINPNGIVFGENASLDLKGSFVGTTASGLQFGEQGSFSATNPEIPGSLTVNPSA
LFFNQVEASGGIINKSQAAAGINPYGFETTGLRVPDGKSLLLVGGDINFDGGRLRAYEGN
IELASVTSPGSIGLDISGDSFSLNIPEDVERGDVSLANQSFISVLGAGGGNFTINARNLE
LSNSSIYAGIAENSDNPNAQAGDINFNATGSIELKNNVLIDNRVYSQGNAGSININANSL
FLGSDSAINNDNFGIGNAGNININARENIFLQGSGNLPSFDNSNDLEDTRLTAISSFVLS
EAIGNAGNIQLTTGNLSVTDGASIYSDTAGKGNAGNITINARDTVSFDNISSISSSIFPE
GVGEGGNIRVTTKNLALTNGSRISTAVLGKGNGGNILIEASDSVKLDGFVGNPNAVSSTE
NLSDRIVPVRILSDLLGFGVGKGGDIQITTNNLSVSNLAEISASTSGEGDAGNITINARD
KVTFSDFGTASSTATNLFDFLPIPIDVGNGGDIRINTGELLLKNGGFISASNNGGKNAGN
IFLDVRDTITVDGVASNGLESSANTFTSNGSAGNIEVKTGSLFLTNSGYISTALSTEETA
DEIPSAGDIKINARDTVKIDGESSLFTSLLSGTGESGNIEIETKSLSINNAMLSTITAGK
GNAGNIKLTIESLSLDNSGFISTGTLDKGDAGNIQINATDLILLSNSSRISSDVGVGAEG
KGGSIDINTQDLTLIDGSRITSGLEGKGRGGEININASESVNLSGIGSNGFFSGIFTSTA
AGASGDAGNVTVTTGDFNLKDYAIVNARTFNDGNAGNITFNANTFEATNGGQVNTSTFNS
GNAGDINLNIKDKIILSGNEQDFTGLFAATSSESTGKGGSVFIDSRSIIIDNNAVISVST
SGKGDAGEIELNADSFDLNNDARITANTLGKGDAGNIELNATDSILLSNSSVIESDVNSG
AEGKGGSIDINTQTLKLIDGSGIASRVFGKGKGGEININASESVTLSGIDSDGFFSGIFT
LTATEASGDAGNLTVTTGDFNLKDDAIVNAITSNDSKAGNITFNANTFAATNGGQVNTST
FSSGKAGNINLNIKDKITFSGIGKSLRSGLFASTSPESSGKGGSIFIDPRLVIIENGAGI
SVGSDGSGDAGDITLQAGTLQLNNGFITAQTASTEGGDITLQISDLLLLRNQSQITTTAG
TAQAGGNGGNITIDSKFIVAPQNENSDITANAFSGNGGTVNINSRGIFGIESQESLTLKS
DITASSEEAIAGETNINKDDTSSIQNSFTELSPNIDTDAIIANSCIARGNKRQENSFRNT
GSGALPTNRAGNIFVSKYATGKVRTVESNNPAWKKGDAIVEPSGLYRLKNGELLLSRECT
N
Download sequence
Identical sequences K9RC57
gi|427736543|ref|YP_007056087.1| WP_015119108.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]