SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736544|ref|YP_007056088.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736544|ref|YP_007056088.1|
Domain Number 1 Region: 71-179,211-337,377-400
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.41e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.0098
Further Details:      
 
Domain Number 2 Region: 577-743
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000706
Family iota-carrageenase 0.096
Further Details:      
 
Domain Number 3 Region: 811-931
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000612
Family P22 tailspike protein 0.056
Further Details:      
 
Domain Number 4 Region: 480-612
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 5 Region: 404-481
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000201
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 
Weak hits

Sequence:  gi|427736544|ref|YP_007056088.1|
Domain Number - Region: 878-1040
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00534
Family Filamentous hemagglutinin FhaB, secretion domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736544|ref|YP_007056088.1|
Sequence length 1223
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MTIIYGLNKCLYLNLVGFLGCLGASLLTTKTLAEQSNITPDNTLGAESSRLNRDVTINGI
NADRIDGGARRDSNLFHSFSEFNINDGQRVYFVNPSGVENILTRVTGGNASNIFGALGVD
GAANLFLINPNGIVFGENSSLDLQGSFVGTTASGIQFGEQGSFSATNPEMPGNLTVNPSA
LFFNQVQASGGIINKSQAPAGINPEGDETTGLRVPDGKSLLLVGGNINFDGGRLKAYEGN
IELASVSAPGTVDLDIAGDSFSLNIPEDVERGDISLTNIAAVSVFGAGGGNFIINARNLE
ISNSFIFAGISGNSVNPETQAGDVNLNATDSILLKDGAGIDNSVYSQGNAGNISLQASNS
IFLVDSIIVNNIEAGGIGKGGNISINAGSLSLNDGSQIQATLDNADVETNLLGGQGNAGN
ININVRDAVTINGIKDGISSDISSFVGIGAVGNAGDININTGSLTLAEGSEINAKTSGQG
NAGNIIVNASQNISLDGSGDVTLRDGSNGTLFTRIISSVNPESVGNAGNIQLNTGTLSVT
DGAFISSSINGKGDSGNITINARDTVTFDTYGFAGSNVFTGGVGKGGDIWVTTGTLSLKN
GGQLSTNVSGEGNAGNIFVEAKDNVELDSKVGSRTSSIDSSLLATGLGKGGDIQITTGLL
SVSNGAQITAFTDGQGNAGNITINASDKVIFDGFDASSGLMSIVSTNGSSNSVGNGGDIR
ITTGEFLLKNGGIISTANFGKGNAGNIFLDVGDTITFDGVGSNKLGVAIPSSARSTVSNG
NAGNIEVKTGSLFLTNGGDMSVEGFPEENSNNIANGGDITINARESIKFDGKNSGLSTAL
GRGTGKSGDIQITTGSLSVTNGAVLFAATSGLGNAGNININARDTVTFDRGFAFNVVNSN
AIGDSGDIEITTGSLFLDNRGFLSTETGGKGDAGKVKVDAADSIALSNSSQITSNVFTGG
EGKGGAIDLDTQTLTLTGGSTISASSNGTGGAGNIEVQAGIIKLDNSSIFAQTAATQGGN
ITLNVSEKLVLRNSSQISTTAGIAQAGGDGGNIDINSKFIVVIPEENSDITANAFEGSGG
KVNITSEAIFGIESRSQPTDKSDITASSQRGISGETSINQDDTSSIQNSFTGLSPNIDTD
AIIANSCIARGNKRQENSLRITGSGALRSDRAGNIFVSKYATGKVRTVESNNPAWKKGDA
IVEPQGLYRLKNGELLLSRECSD
Download sequence
Identical sequences K9RDJ2
gi|427736544|ref|YP_007056088.1| WP_015119109.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]