SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736549|ref|YP_007056093.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736549|ref|YP_007056093.1|
Domain Number 1 Region: 71-179,211-337,377-400
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.32e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 809-930
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000204
Family iota-carrageenase 0.062
Further Details:      
 
Domain Number 3 Region: 707-801
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 4 Region: 481-613
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000001
Family iota-carrageenase 0.077
Further Details:      
 
Domain Number 5 Region: 614-699
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000188
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Weak hits

Sequence:  gi|427736549|ref|YP_007056093.1|
Domain Number - Region: 932-1039
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736549|ref|YP_007056093.1|
Sequence length 1222
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MPIKYSFYERLRFTLAGITGCIGVLLITDSALAQQSNIIPDNTLGRENSRLNRNVEIKGI
NADKIDGGARRNINLFHSFSEFNINDGQAVYFANPDGVENILTRVTGENASNIFGTLGVD
GAANLFLINPSGIVFGENASLDLQGSFVGTTASGLQFGEQGNFSATNPQTPGNLTVNPSA
LFFNQVEASGGIINKSQAPAGINPEENETTGLRVPDGKSLLLVGGNINFDGGRLRAYEGN
IELASVSAPGTVDLDIAGDSFSLNIPQDVERGDVSLTNIAAVSVFGAGGGNFVINARNLE
ISNSSIFAGIGKNSENSDVQAGDVNLNATGSIEVNNDADIDNSVYSQGNTGDIFLKASNS
VSLVDSLISNNIEAGGVGKGGNININSGSLSVTDGSEIQAILRDTDVENNLPGGQGNAGN
INLNVRDAVTIAGIKDGFNSDISSFVGIGAVGNAGDINLNTGSLSLAGGSEINAKTFGQG
NAGNITVNARQNISLDGSGDITLTDGINGTLFTRIISSVNPEAVGNAGNIQLNTGTFSAT
NGALISNSISGKGNAGNITINARYAVTFDTRGYAESSIFSGAVGKGGDIRVTSGTLSLTN
GGQLSTNVFGEGNAGNIFVEARDSVKLDGIVSNRITSIQSDLISQSVGKGGDIQITTGLL
SVTNGAAISAITNGQGDAGNITINASDKVNFDGFDTNTGFPSQVSTVGGSKSIGNGGDIQ
ITTGELLFKSGGLISTINFGEGNAGNIFLDVGDTITFDGLGSSKFPIPSNATSAVSNGNG
GNIEVKTGSLFLTNGGVMSAGAWPDENSNEIANGGSIIINARDRIKFDGKDSSLSTNLIR
GAGKGGDIQITTGSLSVTNGAVLFAATSGQGDAGNIKINSRDTVTFDKGSFASTEVNSNA
IGDGGDIQITTGSLFLDNDGFFSTGTSGKGDAGKVKVDAADSIALSNSSQITSNVFTGGE
GKGGAIDLDTQTLTLTGGSTISASSNGTGGAGNIEVQAGIIKLDNSSIFAQTAATQGGNI
TLNVSEKLVLRNSSQISTTAGIAQAGGDGGNIDINSKFIVVIPEENSDITANAFEGSGGK
VNITSEAIFGIESRSQPTEKSDITASSQRGISGETSINQDDTSSIQNSFTGLSPNIDTDA
IIANSCIARGNKRQENSLRITGSGGLRSDRAGNIFVSKYATGKVRTVESKNQSWKKGDPI
VEPSGLYRLKNGELLLSRECSG
Download sequence
Identical sequences K9RDJ7
WP_015119114.1.44015 gi|427736549|ref|YP_007056093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]