SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736550|ref|YP_007056094.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736550|ref|YP_007056094.1|
Domain Number 1 Region: 34-179,211-337,377-400
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.6e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 
Domain Number 2 Region: 877-1005
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000251
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number 3 Region: 549-681
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000144
Family iota-carrageenase 0.062
Further Details:      
 
Domain Number 4 Region: 1006-1129
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000879
Family iota-carrageenase 0.071
Further Details:      
 
Domain Number 5 Region: 755-868
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000008
Family P22 tailspike protein 0.082
Further Details:      
 
Domain Number 6 Region: 644-753
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000345
Family P22 tailspike protein 0.069
Further Details:      
 
Domain Number 7 Region: 468-550
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|427736550|ref|YP_007056094.1|
Domain Number - Region: 400-469
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00091
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736550|ref|YP_007056094.1|
Sequence length 1364
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MIRKSYLNKCLQLGLAGIASCTNVFLITKPALAQQSNITPDNTLGAESSRLNRNVTINGI
NADRIDGGARRDINLFHSFSEFNINDGQAVYFANPDGVENILTRVTGGNASNILGTLGVD
GAANLFLINPNGIVFGENASLDLQGSFVGTTASGLQFGEQGNFSATNPELPGNLTINPSA
LFFNQVQASGGIINKSQASAGINPNGNKTTGLRVPDGKSLLLVGGNINFDGGRLRAYEGN
IELASVTSPGSVGLDISGNTFRLNVPEDVERGDISLANESDISVLGAGGGNFTINARNLE
ISDSIIFAGIAENSDNPNAQAGDVKLDATGSILLKDSAVIDNSVYSQGNAGDIFLQASNS
VSLVDSAIANDIEAGAVGNGGNINITAGSLSLTDGSEIQALLRGADVENNLPGGQGNAGN
IFLEASNSISLVDRSLIVNNIEAGGVGKGGNINIKAASLSVTDGSSIQAILGNADVENNL
PGGQGNLGNIDINVRDAVTIAGIKDGFNSEIFNFVGIGAIGNAGDININTDSLSLANGSE
INAKTSGQGNAGNININARQNISLDGSGDVILSDGSNGTLFTRIINSVDTGAVGNAGNIQ
LNTGNLSVTNGAFISSSTNGKGDSGNITINASDTISFDTNSSVDTRIFTGGIGKGGDIRV
KTGTITLTNGSQLGTTVTGEGNAGNIFVEARDGVKLDGFFSSQFNGEPFDKISGIESNLV
TGGVGKGGDIQIVTKSLSVSDRASISATSGGQGDAGNININVTDTATFDNLGNASSVFAS
DGVGNGGTIRITAGELLLTSGGNISTNNNGQGNAGDVFLDVRDTISFDGVANNGLPSGVK
TFASNGDSGDVDVKTSSLLLTNTAQISTIGAGQENSNNIANGGDIKIDARDTIKLDGVNT
ALISSLLRGIGKGGDIQIATGSLSVTDGAQISAYTSGRGDAGNININARDTVTFDGIGSN
NFFSSANSAVLSNAVGNGSNITINTKKLFVTNGALLNTFSFGQGNAGNIFINAIDSIILD
GVGNNNIPGGIQTFTFNNGDAGEIQLTTGLLSVTNGAQIITSTNGEGDAGKIKINARDRI
IFDGVGNSGPSGAFSTVESNGVGNAGDIELTTGTLSISNDAIVSVASLGKEDAGDITLQA
GTLQLNNGFITAQTASTKGGNIDLQISELLLLRNGSRITTTAGNQQFGGDGGNIDINSKF
IVSIPSENSDITANAYLGNGGRVNINSNGIFGIETQPSLTNKSDITASSEEAIAGETNIN
TDDTSSIQNSFTELSPNIDTDAIIANSCISRGNKRQENSFRNIGSGGLRSDRAGNIFVSK
YATGEVRTVESNNPAWKKGDAIVEPQGLYRLKNGELLLSRECSD
Download sequence
Identical sequences K9REM2
gi|427736550|ref|YP_007056094.1| WP_015119115.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]