SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736551|ref|YP_007056095.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736551|ref|YP_007056095.1|
Domain Number 1 Region: 31-177,209-366
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.77e-37
Family Filamentous hemagglutinin FhaB, secretion domain 0.0078
Further Details:      
 
Domain Number 2 Region: 823-938
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000596
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 3 Region: 1013-1132
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000596
Family iota-carrageenase 0.056
Further Details:      
 
Domain Number 4 Region: 684-815
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000157
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 5 Region: 364-510
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 
Domain Number 6 Region: 480-603
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 7 Region: 910-1006
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 8 Region: 1262-1310,1357-1386
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 9 Region: 601-684
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000254
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 10 Region: 1134-1261
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000176
Family P22 tailspike protein 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736551|ref|YP_007056095.1|
Sequence length 1619
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MEDILNKCLQLGLAGIASCTNVFLITKPALAQQSNITPDNTLGAESSRLNRNVTINGINA
DKIDGGARRDSNLFHSFSEFNINDGQAVYFANPEGVENILTRVTGGNASNILGTLGVDGA
ANLFLINPNGIVFGENASLDLQGSFVGTTASGLQFGEQGNFSATNPGIPGSLTVNPSALF
FNQVEASGGIINKSQAPAGINPNGDETTGLRVPDGKSFLLVGGEINFDGGRLRAYEGNIE
LASVTSPGSVGLDISGNTFRLNVPEDVERGDISLANESDISVLGAGGGNFTINAHNLEIS
DSIIFAGIAENSDNPNAQAGDVKLDATGSISLKDSAVIDNSVYSQGNAGDIFLEASNSVS
LVDSIIDNNIEAGGVGNGGNININSGSLSVTDGSEIQALLRSADVENNLPGGQGNAGNIN
INVRDAVTITGVKDGFNSDISSSVGIGAVGNAGDININTGSLSLVEGSEINAKTLGQGNA
GNITVNARQNISLDGSGDVTFSDGSNGTISTRIISSVNPEAVGNSGNIQLNTGTFSATNK
AFIANSIDGKGDAGNITINARDTVNLVDSIIANNIEAGRIGKGGNINITAGSLSLTDSSE
IQAFLRDANVEKNLPGGQGNAGNININVRDAVTISGIKDGRASAISSFVGIGAVGNAGDI
NINTGSLSLVEGSEINAKTLGQGNAGNITVNARQSISLDGSGDVILTDGSNGTIPARIIS
FVNPEAVGNAGEIQLNTGTLSVTNEAAISSSTAGKGDAGNITINAKDTVTFDTGGYASGT
VATGTIGNGGDIRLTTRTLSLTNGGQLSSNVAGKGNAGNIFVEAPDSVKLDGVVSSGISG
IQSSLLTGGVGKGGDIQITTGLLSVTNGSAISATTDGQGDAGNININARDKVNLDGFDSN
IGLRSQVSTAGASNSVGNGGDIRITTDELLLQSGGDISSINLGNGNSGNIFLDVGDTITF
DGKTTGKFTVPSSANTYVNNGNAGNIEVKTGSLFLTNGGQMNAAGFPEENSNNVANGGNI
IINARDSIKFDGANSGLATILLWGRGKSGDIQITTGSLSVTNGGELSAFTNARGNAGNIN
INARDTVTFDGGSALNIVSSNAIGDGGDIEITTSSLFLDNTGLIATGTLGKGDAGKVKVD
ASDSISLSNSSSIDSNVLPGGEGIGGTIDIDTQTLTLTSGSQISAAVSREFGNLPGGKGR
GGEININSAESVTLSGISPTGVSSGIIALTERGASGDAGNINVTTGDFRVTDGALVTATT
SNNRNAGDITINADNFAAVNGGQIVNNTRSSGDAGIITLNVRDSVTLSGSDPNFSDRLAV
IEEQIKSPDSTDRVSDFLLIEEGSASGLFASTSDDSTGQGGSIIIDPRLVIIEKGAKVSV
GSNGTGDAGDITLEAGTLQLNNGFIAAQTASTQGGNINLQISELLLLRNESQITTTAGIA
QAGGDGGNIDINSKFIVVIPEENSDITANAFEGSGGKVNITSEAIFGTESRSQPTEKSDI
TASSQRGISGETSINQDDTSSIQNSFTELSPNIDTNAIIANSCIARGNKRQENSFRNIGS
GGLRSDRAGNIFVSKYATGKVRTVESNNPVWEKGDPIIEPSGLYRLKNGELLLSRECSK
Download sequence
Identical sequences K9RDI8
gi|427736551|ref|YP_007056095.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]