SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736683|ref|YP_007056227.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736683|ref|YP_007056227.1|
Domain Number 1 Region: 276-391
Classification Level Classification E-value
Superfamily CalX-like 6.93e-24
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 2 Region: 853-984
Classification Level Classification E-value
Superfamily beta-Roll 2.75e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.00059
Further Details:      
 
Domain Number 3 Region: 539-709
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000004
Family Pancreatic lipase, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736683|ref|YP_007056227.1|
Sequence length 1018
Comment Calx-beta domain-containing protein,putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MDNLENPIINSESLDISSVDSSLNPDLPVENNSGSFQNPISTDDDITLIPQLDNGVFNVD
TTGEFTIDLLFDAGGYESELGIFNLTGMEGLNPGSDEYIQEAARRVLSNSTNGYIVVNDD
SEGAKFTGELGEKDRNEGDYSGIQTFKMNPGDNFALMLVPQGDFRDVLENPSVDGDKRPL
FSLSSANPDKAVQIMQLVKGTIDGGVFGMEDLRLDGNSDTDYNDIIFHVKGALGKATPFE
DLNNYNSNTWDETEAGKQLIEFARNNNINPNESPGKLEFEKSEFNTFESGISTLSAKVIR
TEGDLGEVSATVNLSNGTATAGEDFDNAPIALNFADGEIEKNVAIPIFSDDLKEGSETVN
LSLVNLTGGAILGNQNTATLNIGDEDTSNIISTNSSEDSALSLDTVNVFLKPDEEINFEL
TVTKPQTNSIAALNSPIPQNSNQINVTQIGDDAGYIQEITPTKVETNSTTYNVKLASDGK
GSNQTMMLQTEGSQTTINAITGVNGPYTLPPNLTDSNLAVQGFVTGGSEEGVLLNQTVGN
NPSSRKVGFVEVNNPAQAEQTWLIVHGWNDAPDGKIANTAQKIAQTKPGDRVLLLDWREA
AYNNSEALGVEFGIPGKGNFRAATWISPVAEFAVKALNDFYGIDTQQASESLNLIGHSLG
SLVNSEMGRIYRDGLLLENNNFLAGNTEGARTITALDPPSARNRDENPLFDDANEDIYDV
DGRVKGTQAPEKFADVSVFSRSYVGEKSIAGNPELAVTADEAFQMDFGTISEFATDFGSE
HGRVVRAFNNIIDQQGLIGDLLGIRAYESIDKLPVEDFDELLIRREDNGAYKGIIDVNKE
NVATLLIGKAKTGKKDDIVIGSFINQEINGAEFLNFGGDGRYTGDGNDLFFGESGNDTLI
GNDEDDILFGGKGKDKLDGGSGIDTFVFQPGDGGKSKDEADTIEDFQIGTDKIGLINLEF
GQLSFQEFRRRSGLFSRTTDTAIIANSEFLALVEDVEIEEIQKPEYFVAVDEDELKVS
Download sequence
Identical sequences K9RCJ9
gi|427736683|ref|YP_007056227.1| WP_015119248.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]