SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736779|ref|YP_007056323.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736779|ref|YP_007056323.1|
Domain Number 1 Region: 106-398
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.7e-44
Family Pectate transeliminase 0.0054
Further Details:      
 
Domain Number 2 Region: 381-561
Classification Level Classification E-value
Superfamily Pectin lyase-like 4e-20
Family Galacturonase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736779|ref|YP_007056323.1|
Sequence length 561
Comment hypothetical protein Riv7116_3313 [Rivularia sp. PCC 7116]
Sequence
MDLTESQIFQTEAFLPVNPLEEFIPSENNLSLASLNTGDYVNNLSNEDIAVSNSMDVDIE
SGALIDSDSLDGSYDSDQITGNETAVALVGASVTTSTNPTPQSSGGRFYYVSPSGNDNNS
GSQNQPWKSINYAVSEDSPIAPGDTVLVQPGTYTELISLGKSGSDSQRITLKANGDVTLR
DPNPNSGGFPEGVIQSPGQSNWVIDGFRIENTSWAGISLSDAKNMTVQNNETYQTGSSGI
IVLPKTFFGGGEREITGSNVKILNNTVERANWKWDGPGDTDGDQEALSIWGVDGFEVANN
RMIDGKREGMDIKVGSRNGLIHGNSITSQALISGTYDGFRGGGAIYVDGNRADSFNLDIY
NNEIFSNTADGIVIADEVPSVGDVSDINIYNNVIYGNGRRVENGGRGVAIINNVENVEIV
NNTFANNVQGVYVDNSGRGYNPRNVTIRNNIFSENSYRNAYVEDASNVTLDNNLFVNTEE
FADKTEVLYDGGTRVGNFNAFDNELAESVDFVNSSGNNYRLTSTSPAIDISSFFIGNYAK
LDKDGKQRLTGTGVDAGAYEF
Download sequence
Identical sequences K9RE73
WP_015119344.1.44015 gi|427736779|ref|YP_007056323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]