SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736854|ref|YP_007056398.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736854|ref|YP_007056398.1|
Domain Number 1 Region: 790-1184
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.63e-118
Family PFOR PP module 0.0000000209
Further Details:      
 
Domain Number 2 Region: 3-257
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.94e-78
Family PFOR Pyr module 0.0000000612
Further Details:      
 
Domain Number 3 Region: 418-664
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.53e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000377
Further Details:      
 
Domain Number 4 Region: 259-415
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 7.85e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000517
Further Details:      
 
Domain Number 5 Region: 661-833
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.3e-23
Family Ferredoxin domains from multidomain proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427736854|ref|YP_007056398.1|
Sequence length 1187
Comment pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Rivularia sp. PCC 7116]
Sequence
MNKFATIDGNEAVARVAYRLNEVIAIYPITPSSSMGEWADAWAAGGNRNLWGTIPSVVEM
QSEGGAAAAVHGALQTGSLTTTFTASQGLLLMIPNLYKIAGELTSAVIHVAARSLATHAL
SIFGDQSDVMAARATGFAMLCSASVQEAHDFALIAQAATLKARVPFLHFFDGFRTSHEIQ
KVELLQPEDLEALIDDELIFAHRNRALTPDNPVLRGTAQNPDVYFQARERINLYYDACSG
IVQQVMDEFGKQTGRYYRVFEYYGAPDAEKIIVLMGSGCETVHETIDYTNARGEKWGVIK
VRLFRPFDAELFVKALPSTVKSIAVLDRTKEPGSPGEPLYLDVVTAIYQSWDKGNLPKIV
GGRYGLSSKEFTPAMVLAIYDNLAREKPQNNFTVGINDDLTQTSLDYDSSFSTEAENVVR
AMFYGLGSDGTVGANKNSIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGSQLIRSTY
LIDKANFIGCHQWTFLERVDVLQNAVSGATFLLNSPYDPETVWQHLPAKAQQQIIDKQLK
FYVINANEVARNSGMGGRINTIMQTCFFALAGVLPQDEAIEKIKYSIKKTYGKKGDKVVA
MNLQAVDNTLDNLHKVQVDKSSITGCRDVALQRLTDSPLQKMMAGRGDELPVSVLPADGT
FPTGTSKLEKRNVAQEIPVWEPDVCVQCGKCVMVCPHAAIRAKVYQESELSNAPASFKST
DARDKAFAEEKFTIQVAPSDCTGCNICVDICPAKDKNNSERKAINMESQLPLREQETENW
NYFLKLPLPDRNKLKLNQIRQQQLQEPLFEFSGACAGCGETPYLKLLSQLFGDRALIANA
TGCSSIFGGNLPTTPWTKNAEGRGPAWSNSLFEDNAEFGFGFRLSVDKKAEYAGELLQEL
AYGDDYKSLLPPGLAGSILNAPQKTEADIWEQRERVELLKERLAEELKNSREGKDKINNL
KSLADYLVRKSVWIVGGDGWAYDIDFGGLDHVLASGRNVNVLVMDTEVYSNTGGQSSKST
PKAAVAKFAASGKPAGKKDLGLIAMTYGNIYVASVALGARDEHTLKAFLEAEAYEGPSLI
IAYSHCIAHGIDMSTAMSNQKALVESGRWLLYRYNPDLVKQGRNPLQLDMRQPKNSPEES
MYRENRFKMLKKTKPEIAKQLMEEAQVEVNQRWKMYEYLAARKVVEE
Download sequence
Identical sequences K9REG1
gi|427736854|ref|YP_007056398.1| WP_015119419.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]