SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427736883|ref|YP_007056427.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427736883|ref|YP_007056427.1|
Domain Number 1 Region: 11-149
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.5e-34
Family HD domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427736883|ref|YP_007056427.1|
Sequence length 192
Comment guanosine polyphosphate synthetase/pyrophosphohydrolase [Rivularia sp. PCC 7116]
Sequence
MILKQPAKLTTKFEQALIYATQLHANQTRKVDKIPYISHLMSVSALILEAGGTEDEAIAG
LLHDAIEDQGGKATREEIRQKFGETVVEIVDGCTETDITPKPPWKERKIDYIENIRKGSD
SVKLVSFADKLHNARSLLIGYRNKGDKLWDYFSGSKEDKLWFYGELLEIYQQSCDNFMTV
ELERILEELGNH
Download sequence
Identical sequences K9RD60
WP_015119446.1.44015 gi|427736883|ref|YP_007056427.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]