SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737047|ref|YP_007056591.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737047|ref|YP_007056591.1|
Domain Number 1 Region: 575-698
Classification Level Classification E-value
Superfamily OmpA-like 4.19e-33
Family OmpA-like 0.0006
Further Details:      
 
Domain Number 2 Region: 48-114,165-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.02e-18
Family Galacturonase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737047|ref|YP_007056591.1|
Sequence length 720
Comment outer membrane protein/peptidoglycan-associated (lipo)protein [Rivularia sp. PCC 7116]
Sequence
MYKKISKNPFYQFKQSSKFPVNIKRLLASLPVLLLTTPNIAVAQSNTAISLSVTVNSNQD
GEVEADNNLTLREAIAIVNGSLSLERLSSTEQSLVSSGSNQAEIKFNLPPGQTKITLESV
LPPLTNPGTIVDGTSQPGYDASKSATAEIEIPIPVVEITSAPGEQVFRGLTVAADNITVE
GLSIYGFNSKHTDTASLPPGDIVVVPYNSVLITDKEKRRQGDKGSPPRNVIIKDNWLGIT
SEEQVPEKTSAFGVSVFNAIGTNISRNRIANHEGSAIITGKLAENTQIQSNIIVGNGIAG
MPDAIRLEGKINNSQVTSNLICANDGSGVYLFKPEGSVKIQSNNIKYNGRRLRRAGVYLM
GNNHEVTNNQITNQPGSGVAITAYPDSKRNVIRDNNFANIEGLSIDLNYRNTASVRDFQR
GDGPNPPRNSGNRRLDSANGAINAPEFLSSEFISIDGKVNIDGKAEPGSEIDIYKVNANS
KQQLDLYPAYSALGEVIARVQADEKGRFKATFTNLQPGEIISAIATQSKYGTSEPAANAI
VKSVNNSQSFQKPQSPIQNPNCTSRPVAPTPIPEPPIPQPPIPEPPTPIRLSVPRNVHFA
LDKDFISQKSGEVLDKIAEVMEQYPNIVIELQGHTDSRASVAYNQDLARRRATNARNYLI
KKGIAPERMTIRSFGERKLRTQENNVVDYARNRRVEILFFDVRGIDIEFENQEQDLQIEQ
Download sequence
Identical sequences K9RFE1
WP_015119610.1.44015 gi|427737047|ref|YP_007056591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]