SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737078|ref|YP_007056622.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737078|ref|YP_007056622.1|
Domain Number 1 Region: 19-339
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.15e-117
Family TK-like PP module 0.00000000192
Further Details:      
 
Domain Number 2 Region: 354-546
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-65
Family TK-like Pyr module 0.00000047
Further Details:      
 
Domain Number 3 Region: 551-683
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-45
Family Transketolase C-terminal domain-like 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737078|ref|YP_007056622.1|
Sequence length 683
Comment transketolase [Rivularia sp. PCC 7116]
Sequence
MNANVVKNNRIMAVATQTQTLEQLCINSIRFLAVDAVEKAKSGHPGLPMGAAPMAFVLWD
KFMRFNPKNPKWFNRDRFVLSAGHGSMLQYALLYLAGFDSVSIEDIKNFRQWESSTPGHP
ENFMTLGVEITTGPLGQGIANAVGLAMAEAHLAAMYNKPDAKIVDHYTYCILGDGCNMEG
ISGEACSFAGHQGLGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVKDGNND
LDAIAKAIEEAKSVTDKPTMIKVTTTIGYGAPNKQDTAGIHGAALGADEIKLTRENLGWK
HEPFVVPEDALNHMRKAVERGAGYEEDWNKTFADYKSKYAKEAAEFERYLTGKLPDGWDK
VLPTYTPEDKGLATRKYSQDCLNKLASVLPELIGGSADLTHSNLTEIKESGEFQKGQHQN
RNVHFGVREHGMGGICNGMALHDSGLVPYGATFLIFTDYMRAAIRLSALSHTGTLWVMTH
DSIGQGEDGPTHQPIETLASLRAIPNLNVIRPADGNEVSGAYKCAIERAKKKDPTLLAFT
RQGVPNLKGTSIDNVAKGAYTLVDCDGTPDIILIGTGSEVQLCVGAAEKLSGEGKKVRVV
SMPSWELFEDQDDSYKESVFPSSVTKRVSVEAAASFGWHKYIGTEGAAVSIDRFGASAPG
ATVMEKFGFTVDNVVATAKKVLG
Download sequence
Identical sequences K9RDP4
gi|427737078|ref|YP_007056622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]