SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737096|ref|YP_007056640.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737096|ref|YP_007056640.1|
Domain Number 1 Region: 85-260
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.22e-75
Family HD domain 0.00000194
Further Details:      
 
Domain Number 2 Region: 249-465
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.62e-64
Family RelA/SpoT domain 0.0000108
Further Details:      
 
Domain Number 3 Region: 448-520
Classification Level Classification E-value
Superfamily TGS-like 9.59e-22
Family TGS domain 0.039
Further Details:      
 
Domain Number 4 Region: 724-799
Classification Level Classification E-value
Superfamily ACT-like 0.00000000027
Family AF1403 N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737096|ref|YP_007056640.1|
Sequence length 805
Comment RelA/SpoT family (p)ppGpp synthetase [Rivularia sp. PCC 7116]
Sequence
MMRNNYSIRKTLLAEKNSSKLAKLPRSLKAASQKQQCRLRRPSSLDISPVLSNMNPTVVD
SQINIPLPEWLEDCLNSKVDRSDPQAADKDLISRAFRFAYHLHEGQMRKSGEPYICHPVA
VAGILRDLGGSSVMIAAGFLHDVVEDTEITIEEIEERFGEEVRRLVEGVTKLSKINFKSK
TESQAENFRRMFLAMAQDIRVIVVKLADRLHNMRTLEAMPEHKRRAKALETREIFAPLAN
RLGIWHVKWELEDLAFKYLETDSYRQIQQLVADKRAAREERLTNVTETLRSRLKKAGIEC
VDLSGRPKHLYSIYQKMQRQNKEFHEIFDLAALRIIVKTNEECYRALALVHDSFRPIPGR
FKDYIGLPKPNRYQSLHTGVIGPWGRPMEVQIRTLEMHRIAEYGIAAHWIYKESGGSSNT
QLTAADEKFTWLRQLLEWQNDLKDAQEYLESIKDNLFEDDIYVFTPKGDLVALSPNSTTV
DFAYRIHTEVGNHCAGAKVNGRMVPLSTKLDNGDIVDIITQKNSHPSLDWLNFSATSAAK
NRIKQWYKRSRREENIARGKELLEKELGKSGFENVLKSEPMQTVADKCNYHTVEDLLAAL
GYGEVTLNLVLNRWREIVKEQQPVVTDLDEILSNLPTSASKALRETTTTHRNSDSPIVGV
EGLMYYIAGCCTPIPGEPIIGIVTRGRGISIHRQGCQNLKNTGCERLVPVSWNNSEESKR
HSQSYSVNVQIEALDRVGVFKDILSRLSDQGINVSHANVKTAINQPALIDLGIEVSDRKQ
LEHVFTQIKKMSDILNIRRQGQVED
Download sequence
Identical sequences K9RF34
gi|427737096|ref|YP_007056640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]