SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737151|ref|YP_007056695.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737151|ref|YP_007056695.1|
Domain Number 1 Region: 34-201
Classification Level Classification E-value
Superfamily beta-Roll 4.42e-30
Family Serralysin-like metalloprotease, C-terminal domain 0.00068
Further Details:      
 
Domain Number 2 Region: 348-491
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000955
Family Serralysin-like metalloprotease, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 226-344
Classification Level Classification E-value
Superfamily beta-Roll 0.000000419
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737151|ref|YP_007056695.1|
Sequence length 509
Comment putative calcium-binding protein [Rivularia sp. PCC 7116]
Sequence
MLFYGTAKSEKLNGTHRADFIFGKGGNDTLKGRGGNDFLLGGRGNDSLKGGNGNDVLLGG
KGNDTLEGGNGNDLLKGGKGNDLLKGGNGNDTLKGGKGNDTLEGGNGNDLLKGGKGDDLL
KGGNGNDTLKGGQGDDTLNGGNGNDLLNGGIGNDLLKGNNGNDILLGSKGHDILDGGKGK
DSADYSHLHQAITLEAFGVVHKGSLGTDQLLNIETIIGANGQANTIDGSTATSGVTSFDI
DLSDERLTVENIPGLGDVTFTVKNFVNVVGTTQDDCIIGNSKDNILIGGGGNDYFGGSAG
NDVINGDDSGYDTVDYTGLGEAITLLPTGIIEKDGGLGTDELIRVETIIGDENQANTIDT
SSAESPISIDVDLAAETLEVNNIPVIGSLNRTVVNFVNVIGTAQDDKITGNAEDNIINGF
GGIDNLTGGAGIDTFVLGEDYHVFYSDAGFGDVAIIEDFVSGEDKIQLTGSLDDYSFIQN
SFTNLIAFGDDIIASVNSSFDTNSDFTFA
Download sequence
Identical sequences K9RF93
WP_015119714.1.44015 gi|427737151|ref|YP_007056695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]