SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737297|ref|YP_007056841.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737297|ref|YP_007056841.1|
Domain Number 1 Region: 9-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.16e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00017
Further Details:      
 
Domain Number 2 Region: 357-454
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-22
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427737297|ref|YP_007056841.1|
Sequence length 454
Comment thioredoxin-disulfide reductase [Rivularia sp. PCC 7116]
Sequence
MANPKVENLVIIGSGPAGYTAAIYAGRANLKPVVFEGFEVGGLPGGQLMTTTEVENFPGF
PAGITGPELMDKMKAQAERWGAELYTEDVISVDLSQRPFTVRSSEREFKTHSIAIATGAT
AKRLGLPSEHTFWSRGISACAICDGATPIFHGAELAVIGAGDSAAEEAIYLTKYGDTVNL
LVRSDKMRASKAMQDRVLSNPKIKVHWNTEAVDIFGDDNHMQGIKIRNNKTGEDSQLSVK
GLFYAIGHTPNTSLFKGQLELDDAGYIATKSSVETSVEGVYAVGDVQDREFRQAITAAGS
GCMGAMLAERWLSAEGLLQEFSQKPENNELKPQEEEKTAADTEEDFDINATRHIGSYALR
KIFHDGDRPLIVKYVSPGCGPCHTLKPILNKVVDEFDGKIHFVEIDIDKDREIAQQANVT
GTPTVQIFKNKELLQELKGVKQKSQYRHLLESVL
Download sequence
Identical sequences K9RG30
WP_015119860.1.44015 gi|427737297|ref|YP_007056841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]