SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737380|ref|YP_007056924.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737380|ref|YP_007056924.1|
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-40
Family BPHL domain 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737380|ref|YP_007056924.1|
Sequence length 124
Comment hypothetical protein Riv7116_3937 [Rivularia sp. PCC 7116]
Sequence
MGIFSGMMGNASEVNPEKLERELASLMIEGESMHKAFKLIRDLVVFTNKRIILIDKQGMT
GKKTEFLSIPYKSIKYFSKESAGTLDLDAEIKVWISGDDLPKEFQFKRDNAVDEVYQLLS
YYTL
Download sequence
Identical sequences K9RH40
gi|427737380|ref|YP_007056924.1| WP_015119942.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]