SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737422|ref|YP_007056966.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737422|ref|YP_007056966.1|
Domain Number 1 Region: 30-374
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.69e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.0081
Further Details:      
 
Domain Number 2 Region: 340-499
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000091
Family P22 tailspike protein 0.07
Further Details:      
 
Domain Number 3 Region: 507-632
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000298
Family P22 tailspike protein 0.08
Further Details:      
 
Domain Number 4 Region: 701-791
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|427737422|ref|YP_007056966.1|
Domain Number - Region: 631-704
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0973
Family Filamentous hemagglutinin FhaB, secretion domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737422|ref|YP_007056966.1|
Sequence length 1064
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MARFTPILHYFLLSSLTFCSLISWKSVGAQIIPDSTLGSESSVITPDTIKQIPGDRIDGG
AVRAENLFHSFTEFNIKQGQGAYFSNPSGVKNIFTRVTGNNISKIFGTLGVDGKANLFLL
NPNGIIFGKNARLDVNGSFVGSTANAIEFENQGFFSATNPQNASQLLTIKPSAFLFNQLE
SGRIESSSIAPLEDNLFGLRVPDGRSLLFLGGEIFVNGGWLNAPGGRVELTGVADTGVVG
INFDSNNPSLKVADKLGRSNVIINNFGRANVIGDNGGSIEINANNINLIAGYLDAGIAPG
LGSDESKAGDITLNAQKSTVIKGITTPEFIAKSRIRNFIYAGATGEGGDIKINTESLAVD
DFSSLETSTQSRGNAGRVLIQAKDEVSLREGSTIFNTVSSGGIGNAGGVKIQANSFSLLE
GAEIQAGNTGGIGNAGDVNIDVRDGILFDGLYSDGFASGIFNGVTEQGIGDSGEIYIKAN
SFTLSDGARLQTKSEGQGDTGNVKIDVGDRIVFNGTKTNPDLDFEHLTGIFTTLETKSFR
QGGDVNIKTGSLNIINGAEITSNSFGLGNSGNINIEARKDITLDGFNNHGGTSGFFSALG
NSENPATGKGGNINISANSLSLTNGATIASTTSTGSQGDAGKINIVTDKQVLLDGAGLNE
SPGGIFAAVETGAIGNANDIEIKTDLLSVINNSSLSTSIAGKGNAGNIKTEARILEVADG
GRLVTTTSGSAKAGNIILSVRDNVILSGSDTGLFANTTEGSSGNGGNIIVEPSKITVRDG
AEIAVDSQGQGIGGTVELAADFLTLDNGLISAENRSNTGGNIKLHLQKLLLLRNGSQISS
TAGNREFGGDGGNININAPNGFVVAVPKEDSDITANAFRGNGGKVEIFTQGIFGIRFQEQ
LTQKSDITASSRFGVRGNVALVTLEIDPTSGLIELPANLVDAANQISNACTPGSREFENS
LVSTGRGGLPMSPTEPLQENNALSAWVRLKPELISRKNTRIKPRSTTVSNSNNDNVRKKN
QIVEATGWIVDKDGSIEFVAQAHQKTSHNPRRKSADCYVRSATG
Download sequence
Identical sequences K9RGI7
WP_015119984.1.44015 gi|427737422|ref|YP_007056966.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]