SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737424|ref|YP_007056968.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737424|ref|YP_007056968.1|
Domain Number 1 Region: 31-340
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.11e-45
Family Filamentous hemagglutinin FhaB, secretion domain 0.014
Further Details:      
 
Domain Number 2 Region: 458-576
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000659
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 576-700
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000895
Family Filamentous hemagglutinin FhaB, secretion domain 0.07
Further Details:      
 
Domain Number 4 Region: 341-458
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000502
Family P22 tailspike protein 0.08
Further Details:      
 
Domain Number 5 Region: 700-825
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000122
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 6 Region: 923-1015
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000198
Family P22 tailspike protein 0.074
Further Details:      
 
Weak hits

Sequence:  gi|427737424|ref|YP_007056968.1|
Domain Number - Region: 827-918
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00345
Family Filamentous hemagglutinin FhaB, secretion domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737424|ref|YP_007056968.1|
Sequence length 1272
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MGIFIVCGVFATEAKVVLADDIVPDSTLPNPSKTNIQNNITTISGGTQAGNNLLHSFQEF
SVLSGNTAFFDNSPNIVNIINRVTGNSISNIDGLLKANGSANLFLINPNGIIFGENAGLD
IGGSFLATSADSMKFSDGSTFSAINPQELPLLTINVPIGLQYGNGGDINLGKSNLEVSSG
KTLAFVGGNINLEGGQLIAESGRIELGGLTGTGEVTFNTSDNNLSLNYPVGIQRGNLLIA
GAKVLSDGGGSIWVNARDVDISEVGVLRVGFAEGLGGVGAIAGDINVSATGDITLSGGSV
IASYIFPNGIGEAGNINLEAGSLNLRDGSQLFSSTAGEGNSGNINVDVREQIVFDSGSNI
VSSVAEQAKGKAGDVTLTTGSFSITNGSQLNAFTNGKGNTGNIIINARDAVILDGSSSIV
NSVDKNGIGEAGDINLNAGSLNLRDGSQLFSSTAGEGNSGNINVSAQNNIVFDSGSNIVT
SVAEQAKGKAGDITLNTGSFSITNGSQLNVSTNGKGNTGNITINARDTVILDGSSIILNS
VDKNGIGEAGDINLNAGSLNLFDGSQLFSSTAGEGNSGNINVDVREQIVFDSAGSAGSTT
GIISSVDTTGAGKAGDVTLTTGSFSMTNGSQLNASTNGKGNTGNITINARDTVSLDGFSS
IVNSVDKNGIGEAGDINLNAGSLNLFDGSQLFSSTAGEGNSGNINVDVREQIVFDSGSNI
VTSVAEQAKGKAGDVTLNTGSLLLTNGSQINANVQSENQVSAGNIYINARDTISLDGTAK
NGQVSGIFATVNENAVGSGGDIDIETGSLSVTGGAGLFALTKGRGDAGDVSINARDRVSF
DGTNQNAGSSGIFASVENNAVGNAGNTIIEAESLFVTGGAGLFALTKGRGNAGNVSINAR
DRVSFNGTNQNGGSSGIFASVENNAVGNAGNINIETDSLFVTGSAGLFALTEGEGSAGNI
NINAGKQSFLEGFDSGIYSTVEKQAVGDGKEINIITEKLSVENGARLSSTSEGNGAAGNI
AINANSIRLNRGYLNSNTVGKEGNINLRSTDLILRNESKIRTNATGQNIIGGNIDINTGV
LAGFENSDITANSIDSRGGNVRINTEGVVGIKFRDLLSPLSDITAAGKNSELSGNVEVNT
QLDPSRGLVELPVNLVDASNQISKVCTPRNRELNTFVSTGRGGLPMSPTEPLQDTNTLSA
WVKLKPQPRNSASTISKPSTTVAHNNKVKKRNRIIEATGWIVDKHGNIEFVAQANQNNFK
SLSQTAACSVSN
Download sequence
Identical sequences K9RFZ4
gi|427737424|ref|YP_007056968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]