SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737426|ref|YP_007056970.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737426|ref|YP_007056970.1|
Domain Number 1 Region: 30-372
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.05e-44
Family Filamentous hemagglutinin FhaB, secretion domain 0.012
Further Details:      
 
Domain Number 2 Region: 377-521,561-582
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000122
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 939-1039
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.042
Further Details:      
 
Domain Number 4 Region: 791-840,868-897
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000973
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 5 Region: 624-756
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737426|ref|YP_007056970.1|
Sequence length 1306
Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence
MSQASMGFYRIKGLAIVMVSAIALDANSSVAQITPDTTLPVDFKVDKVNQTFNIDGGKKA
GNNLFHSFKEFSVPTGWEAVFKNGADIQNIFTRVTGKSISNIDGLIKANGSANLFLMNPN
GILFGENARLDIGGSFIGTTAESMKFPDSSEFSAVNPQAPPLLKINVPLGLQFGKSPGNI
KVGNNLQTSLTDKSPTLLEVKPGKTLALIGGEVELNGERLRAPGGRIELGGLASAGTVEI
SHDGSFSFPLGVERADTLLNRGEVDVTGGGGGDISIHARNIKLNLGTDICAGIGGDDACG
KLASNTTGAVGSQAGDIMLNATGDITGDKGVKINNRVNRGVIGNSGNIDIKTRSLTMSDG
AKISASTFGKGNAGNIIVRAKDIISLTGGDIFSTVGAGGVGKAGNININATSLKLENAAQ
LLTITREASKTQPAGRGNAGNVDIKVTGAVDIVGIKNNTLPSGIFSRVKTGTNGNGGDIT
IDAGSFKLRDGAQISTSTSGEGNAGNITVSAKTGSLEVLNGAQVSASTFGKGNAGNIIVL
AKDAISLKDSYILSTVGAGGVGKGGNIDIDAASLKLENAAQLLTITREASKTQPAGRGNA
GNVDIKVTGAVDIVGMKNNTLPSGIFSRVKTGTNGNGGDITIDAGSFKLRDGAQISTSTS
GEGNAGNVTVSAKTGSLEVLNGAQVSASTNGKGNAGSVNINANDLVKIDGQGVFTGAFSQ
VNKEANGNAGDVSIAANSLEIVNRARLSTSTSGEGNAGDLSIKATESVKVIGTGETNTHP
SLSANVSGRASRSDRKGGDLRIDTKKLVITNAQVSASTSGLGNAGNLSVNASESVEISGK
IFSTNKKDPTTPINNPAGLFSQVNSEGEGNGGNLSVETPSLSVGNGGKIQVAVFGKGDAG
KLSIRASDIDIYDTPGEADFFQGGIFAGFQFDGDESTALPEGDFGGAIAIETDRLRVRDG
GTVTVFTEGNGNAGRLQINAKDYIEVYGKVNALTTNNIFTSKISGEATTGSTGNGGSVKL
NSDKFIVRDGGKISVDNQGEKVGGDIEIYGGSLTLDNGGKISAETRSNTGGNINLNLQDL
LLLRNGSQISTTAGNEQFGGDGGNIKINAPLIVAVPKENSDISANAFMGNGGEVNIKAQG
IFGIEFQKRPTSQSDITASSKFGVRGTVNINTPELDPTSGLIELPLDVVDASQQISNACT
PRSRQFENRFVVMGRGGLPMSPTEPLQDTNTLSAWVKLKPQSQTAALRKISNLDNNSRKN
EITKRNQIIEATGWIVDKNGNIEFVAQANQSNFKSLSQTAACSVSE
Download sequence
Identical sequences K9RG29
WP_015119988.1.44015 gi|427737426|ref|YP_007056970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]