SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737429|ref|YP_007056973.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737429|ref|YP_007056973.1|
Domain Number 1 Region: 7-83
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00000000198
Family Hypothetical protein TT1808 (TTHA1514) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737429|ref|YP_007056973.1|
Sequence length 85
Comment hypothetical protein Riv7116_3986 [Rivularia sp. PCC 7116]
Sequence
MLNPTVTIPEAFKVSHEQFKELAIANRDLRLERTEEGELVVIPLNGGEAGAKNTNITGQL
WLWNRQSKIGIALLYRVKIYYPNLF
Download sequence
Identical sequences K9RG01
WP_015119991.1.44015 gi|427737429|ref|YP_007056973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]