SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737459|ref|YP_007057003.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737459|ref|YP_007057003.1|
Domain Number 1 Region: 202-527
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.88e-23
Family Pectate transeliminase 0.08
Further Details:      
 
Domain Number 2 Region: 447-704
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000132
Family Pectate lyase-like 0.064
Further Details:      
 
Weak hits

Sequence:  gi|427737459|ref|YP_007057003.1|
Domain Number - Region: 671-912
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000178
Family Galacturonase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427737459|ref|YP_007057003.1|
Sequence length 920
Comment hypothetical protein Riv7116_4016 [Rivularia sp. PCC 7116]
Sequence
MEFSTNPNSDSLQFSSSLNSDNLLNPIDDGNLLESTSITFIDSSISDYETLIAGMEETQI
HMLDSSQDAITQITQTLTGSTGIKSLHIFSHGNSGVLDFAGNNLNDANLGAYSNQIQSWG
EALSTDADILFYGCNLAATDTGKQFVNKISNLTSADVAASDDLTGNTNRGGDWDLEFNTG
SIETEVIVQNWAQNAYQDVLASFTVDSIADVVDSNDGVTTLREAIDSANAIAGFDSIVFD
SSLFGSQQTIGLNLGQLNITDSVSIIAPEFVTVSGNQAFRVFEIAAGATVNLSGLIITDG
KVTGDNGGGIKSSGNLTLENTIVRNNFVEDGNGGGIDNTGDILTVINSTISSNSARGGFG
TSDGGGIYNIGKTLTLSNSSITNNQGSDGGGIYNNDNNFTLNSSVITGNSISTSGDAFGG
GIYNAGDNLVVNQSVISNNRIISLFNVAEGGGIYNVGKNLILNNSFIANNVSQNGGGIYS
KDANLTVNNSTISGNEVVAARGGNIGGGGINATGIITLNNTTISDNSVNGSRFGNVAGGG
IWVNGIITINNSKITRNSATPRISGRGNSAFGGGIYADGNLTMNNSAVSENYVESTVSDF
TLLSGGGIFTKGNATLNNSNISNNNAIGRGFGESISRGGGISNIANLTINNTTVSNNKAI
NQGKNVSSGGGISNIGTLSVLNINNSTISGNEAFEGGGISNGGNNFATPELKDLINPGGT
INISNSNISDNKAESQGGGIVNFDKGNVTVTRTGFNNNSARDGGAIAANPNGKVMVTDSS
LTNNIASNIGGAIFNSSIFDVSRSNLQNNKALVSGGAIWNVGTLNVSSSSVDDNQATFEG
GGIVNFADGTATVTSSAVRRNKAENGGGIFNRGFLSLLSSYLAFNQADNGDDLFNAQDGI
VEIINTTIAENILNQGEIIS
Download sequence
Identical sequences K9RG31
gi|427737459|ref|YP_007057003.1| WP_015120021.1.44015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]