SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427737498|ref|YP_007057042.1| from Rivularia sp. PCC 7116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427737498|ref|YP_007057042.1|
Domain Number 1 Region: 254-390
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000109
Family Laminin G-like module 0.057
Further Details:      
 
Domain Number 2 Region: 180-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000247
Family Pentraxin (pentaxin) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427737498|ref|YP_007057042.1|
Sequence length 502
Comment VanZ like family protein [Rivularia sp. PCC 7116]
Sequence
MNQDNSTESKTSIFLILVITSVVIVLAATLYPFNFALPDSISKRELVNSFDNNSFFNDQV
NNVLLFLPLGFGLTGLLQKRKVKLVWQIFAAFLASAALSSTVELLQILVPSRTPTPADIF
NNSFGGFFGLICFYIWNSRSFKAILHRIETSRASNSISKITLFFTGYVILTFLITIPWQA
TTNLTGWNPSFPLIVGNERTANRGWEGYISQLNIANQAFSQNQVKQLFLPNNSFENLGNS
AIAAYEFKGKAPYQDRIGKQPDLLWNGESAIQNEQGVFISSNNWLKTATPVTSLSKSISK
ASEFTISTTLATNKTEQVGPARIISLSNDSFRRNFTLGQQGSDLVFRLRTPLTGANASDV
KLEVPGVFSDIQPHQIVITYSKSSLIIYVDSISNIHTLNLLDLIPKEKRFFYYGITFIPF
GLCLALLTTLAKRKINFYRLLLPAGILLPSLILEGILVQESGKSISPKNIFLGILFTAGT
MFILKARTGTVISEQSTVNSQQ
Download sequence
Identical sequences K9REW2
WP_015120058.1.44015 gi|427737498|ref|YP_007057042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]